Sign in Dashboard Get started
  1. Packages
  2. Packages
  3. Alibaba Cloud Provider
  4. API Docs
  5. vpn
  6. getGatewayEnhancedVpnGateways
Viewing docs for Alibaba Cloud v3.104.0
published on Thursday, Jun 25, 2026 by Pulumi
Schema (JSON)
pulumi/pulumi-alicloud

alicloud.vpn.getGatewayEnhancedVpnGateways

alicloud logo
Viewing docs for Alibaba Cloud v3.104.0
published on Thursday, Jun 25, 2026 by Pulumi
Schema (JSON)
pulumi/pulumi-alicloud

    This data source provides Vpn Gateway Enhanced Vpn Gateway available to the user.What is Enhanced Vpn Gateway

    NOTE: Available since v1.280.0.

    Example Usage

    import * as pulumi from "@pulumi/pulumi";
import * as alicloud from "@pulumi/alicloud";

const config = new pulumi.Config();
const name = config.get("name") || "terraform-example";
const region = config.get("region") || "ap-southeast-3";
const zone2 = config.get("zone2") || "ap-southeast-3a";
const zone1 = config.get("zone1") || "ap-southeast-3b";
const defaulttYTx5F = new alicloud.vpc.Network("defaulttYTx5F", {
    cidrBlock: "192.168.0.0/16",
    isDefault: false,
});
const defaultTRk7k3 = new alicloud.vpc.Switch("defaultTRk7k3", {
    vpcId: defaulttYTx5F.id,
    zoneId: zone1,
    cidrBlock: "192.168.10.0/24",
});
const default23kGFr = new alicloud.vpc.Switch("default23kGFr", {
    vpcId: defaulttYTx5F.id,
    zoneId: zone2,
    cidrBlock: "192.168.20.0/24",
});
const defaultGatewayEnhancedVpnGateway = new alicloud.vpn.GatewayEnhancedVpnGateway("default", {
    vpnType: "Normal",
    description: "default",
    disasterRecoveryVswitchId: default23kGFr.id,
    vpcId: defaulttYTx5F.id,
    vpnGatewayName: "default",
    networkType: "public",
    vswitchId: defaultTRk7k3.id,
    gatewayType: "Enhanced.SiteToSite",
    autoPropagate: false,
});
const _default = alicloud.vpn.getGatewayEnhancedVpnGatewaysOutput({
    ids: [defaultGatewayEnhancedVpnGateway.id],
    vpcId: defaulttYTx5F.id,
});
export const alicloudVpnGatewayEnhancedVpnGatewayExampleId = _default.apply(_default => _default.gateways?.[0]?.id);

    import pulumi
import pulumi_alicloud as alicloud

config = pulumi.Config()
name = config.get("name")
if name is None:
    name = "terraform-example"
region = config.get("region")
if region is None:
    region = "ap-southeast-3"
zone2 = config.get("zone2")
if zone2 is None:
    zone2 = "ap-southeast-3a"
zone1 = config.get("zone1")
if zone1 is None:
    zone1 = "ap-southeast-3b"
defaultt_y_tx5_f = alicloud.vpc.Network("defaulttYTx5F",
    cidr_block="192.168.0.0/16",
    is_default=False)
default_t_rk7k3 = alicloud.vpc.Switch("defaultTRk7k3",
    vpc_id=defaultt_y_tx5_f.id,
    zone_id=zone1,
    cidr_block="192.168.10.0/24")
default23k_g_fr = alicloud.vpc.Switch("default23kGFr",
    vpc_id=defaultt_y_tx5_f.id,
    zone_id=zone2,
    cidr_block="192.168.20.0/24")
default_gateway_enhanced_vpn_gateway = alicloud.vpn.GatewayEnhancedVpnGateway("default",
    vpn_type="Normal",
    description="default",
    disaster_recovery_vswitch_id=default23k_g_fr.id,
    vpc_id=defaultt_y_tx5_f.id,
    vpn_gateway_name="default",
    network_type="public",
    vswitch_id=default_t_rk7k3.id,
    gateway_type="Enhanced.SiteToSite",
    auto_propagate=False)
default = alicloud.vpn.get_gateway_enhanced_vpn_gateways_output(ids=[default_gateway_enhanced_vpn_gateway.id],
    vpc_id=defaultt_y_tx5_f.id)
pulumi.export("alicloudVpnGatewayEnhancedVpnGatewayExampleId", default.gateways[0].id)

    package main

import (
	"github.com/pulumi/pulumi-alicloud/sdk/v3/go/alicloud/vpc"
	"github.com/pulumi/pulumi-alicloud/sdk/v3/go/alicloud/vpn"
	"github.com/pulumi/pulumi/sdk/v3/go/pulumi"
	"github.com/pulumi/pulumi/sdk/v3/go/pulumi/config"
)

func main() {
	pulumi.Run(func(ctx *pulumi.Context) error {
		cfg := config.New(ctx, "")
		name := "terraform-example"
		if param := cfg.Get("name"); param != "" {
			name = param
		}
		region := "ap-southeast-3"
		if param := cfg.Get("region"); param != "" {
			region = param
		}
		zone2 := "ap-southeast-3a"
		if param := cfg.Get("zone2"); param != "" {
			zone2 = param
		}
		zone1 := "ap-southeast-3b"
		if param := cfg.Get("zone1"); param != "" {
			zone1 = param
		}
		defaulttYTx5F, err := vpc.NewNetwork(ctx, "defaulttYTx5F", &vpc.NetworkArgs{
			CidrBlock: pulumi.String("192.168.0.0/16"),
			IsDefault: pulumi.Bool(false),
		})
		if err != nil {
			return err
		}
		defaultTRk7k3, err := vpc.NewSwitch(ctx, "defaultTRk7k3", &vpc.SwitchArgs{
			VpcId:     defaulttYTx5F.ID(),
			ZoneId:    pulumi.String(zone1),
			CidrBlock: pulumi.String("192.168.10.0/24"),
		})
		if err != nil {
			return err
		}
		default23kGFr, err := vpc.NewSwitch(ctx, "default23kGFr", &vpc.SwitchArgs{
			VpcId:     defaulttYTx5F.ID(),
			ZoneId:    pulumi.String(zone2),
			CidrBlock: pulumi.String("192.168.20.0/24"),
		})
		if err != nil {
			return err
		}
		defaultGatewayEnhancedVpnGateway, err := vpn.NewGatewayEnhancedVpnGateway(ctx, "default", &vpn.GatewayEnhancedVpnGatewayArgs{
			VpnType:                   pulumi.String("Normal"),
			Description:               pulumi.String("default"),
			DisasterRecoveryVswitchId: default23kGFr.ID(),
			VpcId:                     defaulttYTx5F.ID(),
			VpnGatewayName:            pulumi.String("default"),
			NetworkType:               pulumi.String("public"),
			VswitchId:                 defaultTRk7k3.ID(),
			GatewayType:               pulumi.String("Enhanced.SiteToSite"),
			AutoPropagate:             pulumi.Bool(false),
		})
		if err != nil {
			return err
		}
		_default := vpn.GetGatewayEnhancedVpnGatewaysOutput(ctx, vpn.GetGatewayEnhancedVpnGatewaysOutputArgs{
			Ids: pulumi.StringArray{
				defaultGatewayEnhancedVpnGateway.ID(),
			},
			VpcId: defaulttYTx5F.ID(),
		}, nil)
		ctx.Export("alicloudVpnGatewayEnhancedVpnGatewayExampleId", _default.ApplyT(func(_default vpn.GetGatewayEnhancedVpnGatewaysResult) (*string, error) {
			return _default.Gateways[0].Id, nil
		}).(pulumi.StringPtrOutput))
		return nil
	})
}

    using System.Collections.Generic;
using System.Linq;
using Pulumi;
using AliCloud = Pulumi.AliCloud;

return await Deployment.RunAsync(() => 
{
    var config = new Config();
    var name = config.Get("name") ?? "terraform-example";
    var region = config.Get("region") ?? "ap-southeast-3";
    var zone2 = config.Get("zone2") ?? "ap-southeast-3a";
    var zone1 = config.Get("zone1") ?? "ap-southeast-3b";
    var defaulttYTx5F = new AliCloud.Vpc.Network("defaulttYTx5F", new()
    {
        CidrBlock = "192.168.0.0/16",
        IsDefault = false,
    });

    var defaultTRk7k3 = new AliCloud.Vpc.Switch("defaultTRk7k3", new()
    {
        VpcId = defaulttYTx5F.Id,
        ZoneId = zone1,
        CidrBlock = "192.168.10.0/24",
    });

    var default23kGFr = new AliCloud.Vpc.Switch("default23kGFr", new()
    {
        VpcId = defaulttYTx5F.Id,
        ZoneId = zone2,
        CidrBlock = "192.168.20.0/24",
    });

    var defaultGatewayEnhancedVpnGateway = new AliCloud.Vpn.GatewayEnhancedVpnGateway("default", new()
    {
        VpnType = "Normal",
        Description = "default",
        DisasterRecoveryVswitchId = default23kGFr.Id,
        VpcId = defaulttYTx5F.Id,
        VpnGatewayName = "default",
        NetworkType = "public",
        VswitchId = defaultTRk7k3.Id,
        GatewayType = "Enhanced.SiteToSite",
        AutoPropagate = false,
    });

    var @default = AliCloud.Vpn.GetGatewayEnhancedVpnGateways.Invoke(new()
    {
        Ids = new[]
        {
            defaultGatewayEnhancedVpnGateway.Id,
        },
        VpcId = defaulttYTx5F.Id,
    });

    return new Dictionary<string, object?>
    {
        ["alicloudVpnGatewayEnhancedVpnGatewayExampleId"] = @default.Apply(@default => @default.Apply(getGatewayEnhancedVpnGatewaysResult => getGatewayEnhancedVpnGatewaysResult.Gateways[0]?.Id)),
    };
});

    package generated_program;

import com.pulumi.Context;
import com.pulumi.Pulumi;
import com.pulumi.core.Output;
import com.pulumi.alicloud.vpc.Network;
import com.pulumi.alicloud.vpc.NetworkArgs;
import com.pulumi.alicloud.vpc.Switch;
import com.pulumi.alicloud.vpc.SwitchArgs;
import com.pulumi.alicloud.vpn.GatewayEnhancedVpnGateway;
import com.pulumi.alicloud.vpn.GatewayEnhancedVpnGatewayArgs;
import com.pulumi.alicloud.vpn.VpnFunctions;
import com.pulumi.alicloud.vpn.inputs.GetGatewayEnhancedVpnGatewaysArgs;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Map;
import java.io.File;
import java.nio.file.Files;
import java.nio.file.Paths;

public class App {
    public static void main(String[] args) {
        Pulumi.run(App::stack);
    }

    public static void stack(Context ctx) {
        final var config = ctx.config();
        final var name = config.get("name").orElse("terraform-example");
        final var region = config.get("region").orElse("ap-southeast-3");
        final var zone2 = config.get("zone2").orElse("ap-southeast-3a");
        final var zone1 = config.get("zone1").orElse("ap-southeast-3b");
        var defaulttYTx5F = new Network("defaulttYTx5F", NetworkArgs.builder()
            .cidrBlock("192.168.0.0/16")
            .isDefault(false)
            .build());

        var defaultTRk7k3 = new Switch("defaultTRk7k3", SwitchArgs.builder()
            .vpcId(defaulttYTx5F.id())
            .zoneId(zone1)
            .cidrBlock("192.168.10.0/24")
            .build());

        var default23kGFr = new Switch("default23kGFr", SwitchArgs.builder()
            .vpcId(defaulttYTx5F.id())
            .zoneId(zone2)
            .cidrBlock("192.168.20.0/24")
            .build());

        var defaultGatewayEnhancedVpnGateway = new GatewayEnhancedVpnGateway("defaultGatewayEnhancedVpnGateway", GatewayEnhancedVpnGatewayArgs.builder()
            .vpnType("Normal")
            .description("default")
            .disasterRecoveryVswitchId(default23kGFr.id())
            .vpcId(defaulttYTx5F.id())
            .vpnGatewayName("default")
            .networkType("public")
            .vswitchId(defaultTRk7k3.id())
            .gatewayType("Enhanced.SiteToSite")
            .autoPropagate(false)
            .build());

        final var default = VpnFunctions.getGatewayEnhancedVpnGateways(GetGatewayEnhancedVpnGatewaysArgs.builder()
            .ids(defaultGatewayEnhancedVpnGateway.id())
            .vpcId(defaulttYTx5F.id())
            .build());

        ctx.export("alicloudVpnGatewayEnhancedVpnGatewayExampleId", default_.applyValue(_default_ -> _default_.gateways()[0].id()));
    }
}

    configuration:
  name:
    type: string
    default: terraform-example
  region:
    type: string
    default: ap-southeast-3
  zone2:
    type: string
    default: ap-southeast-3a
  zone1:
    type: string
    default: ap-southeast-3b
resources:
  defaulttYTx5F:
    type: alicloud:vpc:Network
    properties:
      cidrBlock: 192.168.0.0/16
      isDefault: false
  defaultTRk7k3:
    type: alicloud:vpc:Switch
    properties:
      vpcId: ${defaulttYTx5F.id}
      zoneId: ${zone1}
      cidrBlock: 192.168.10.0/24
  default23kGFr:
    type: alicloud:vpc:Switch
    properties:
      vpcId: ${defaulttYTx5F.id}
      zoneId: ${zone2}
      cidrBlock: 192.168.20.0/24
  defaultGatewayEnhancedVpnGateway:
    type: alicloud:vpn:GatewayEnhancedVpnGateway
    name: default
    properties:
      vpnType: Normal
      description: default
      disasterRecoveryVswitchId: ${default23kGFr.id}
      vpcId: ${defaulttYTx5F.id}
      vpnGatewayName: default
      networkType: public
      vswitchId: ${defaultTRk7k3.id}
      gatewayType: Enhanced.SiteToSite
      autoPropagate: false
variables:
  default:
    fn::invoke:
      function: alicloud:vpn:getGatewayEnhancedVpnGateways
      arguments:
        ids:
          - ${defaultGatewayEnhancedVpnGateway.id}
        vpcId: ${defaulttYTx5F.id}
outputs:
  alicloudVpnGatewayEnhancedVpnGatewayExampleId: ${default.gateways[0].id}

    pulumi {
  required_providers {
    alicloud = {
      source = "pulumi/alicloud"
    }
  }
}

data "alicloud_vpn_getgatewayenhancedvpngateways" "default" {
  ids    = [alicloud_vpn_gatewayenhancedvpngateway.default.id]
  vpc_id = alicloud_vpc_network.defaulttYTx5F.id
}

resource "alicloud_vpc_network" "defaulttYTx5F" {
  cidr_block = "192.168.0.0/16"
  is_default = false
}
resource "alicloud_vpc_switch" "defaultTRk7k3" {
  vpc_id     = alicloud_vpc_network.defaulttYTx5F.id
  zone_id    = var.zone1
  cidr_block = "192.168.10.0/24"
}
resource "alicloud_vpc_switch" "default23kGFr" {
  vpc_id     = alicloud_vpc_network.defaulttYTx5F.id
  zone_id    = var.zone2
  cidr_block = "192.168.20.0/24"
}
resource "alicloud_vpn_gatewayenhancedvpngateway" "default" {
  vpn_type                     = "Normal"
  description                  = "default"
  disaster_recovery_vswitch_id = alicloud_vpc_switch.default23kGFr.id
  vpc_id                       = alicloud_vpc_network.defaulttYTx5F.id
  vpn_gateway_name             = "default"
  network_type                 = "public"
  vswitch_id                   = alicloud_vpc_switch.defaultTRk7k3.id
  gateway_type                 = "Enhanced.SiteToSite"
  auto_propagate               = false
}
variable "name" {
  type    = string
  default = "terraform-example"
}
variable "region" {
  type    = string
  default = "ap-southeast-3"
}
variable "zone2" {
  type    = string
  default = "ap-southeast-3a"
}
variable "zone1" {
  type    = string
  default = "ap-southeast-3b"
}
output "alicloudVpnGatewayEnhancedVpnGatewayExampleId" {
  value = data.alicloud_vpn_getgatewayenhancedvpngateways.default.gateways[0].id
}

    Using getGatewayEnhancedVpnGateways

    Two invocation forms are available. The direct form accepts plain arguments and either blocks until the result value is available, or returns a Promise-wrapped result. The output form accepts Input-wrapped arguments and returns an Output-wrapped result.

    function getGatewayEnhancedVpnGateways(args: GetGatewayEnhancedVpnGatewaysArgs, opts?: InvokeOptions): Promise<GetGatewayEnhancedVpnGatewaysResult>
function getGatewayEnhancedVpnGatewaysOutput(args: GetGatewayEnhancedVpnGatewaysOutputArgs, opts?: InvokeOptions): Output<GetGatewayEnhancedVpnGatewaysResult>
    def get_gateway_enhanced_vpn_gateways(enable_details: Optional[bool] = None,
                                      ids: Optional[Sequence[str]] = None,
                                      output_file: Optional[str] = None,
                                      status: Optional[str] = None,
                                      vpc_id: Optional[str] = None,
                                      vpn_instance_id: Optional[str] = None,
                                      opts: Optional[InvokeOptions] = None) -> GetGatewayEnhancedVpnGatewaysResult
def get_gateway_enhanced_vpn_gateways_output(enable_details: pulumi.Input[Optional[bool]] = None,
                                      ids: pulumi.Input[Optional[Sequence[pulumi.Input[str]]]] = None,
                                      output_file: pulumi.Input[Optional[str]] = None,
                                      status: pulumi.Input[Optional[str]] = None,
                                      vpc_id: pulumi.Input[Optional[str]] = None,
                                      vpn_instance_id: pulumi.Input[Optional[str]] = None,
                                      opts: Optional[InvokeOptions] = None) -> Output[GetGatewayEnhancedVpnGatewaysResult]
    func GetGatewayEnhancedVpnGateways(ctx *Context, args *GetGatewayEnhancedVpnGatewaysArgs, opts ...InvokeOption) (*GetGatewayEnhancedVpnGatewaysResult, error)
func GetGatewayEnhancedVpnGatewaysOutput(ctx *Context, args *GetGatewayEnhancedVpnGatewaysOutputArgs, opts ...InvokeOption) GetGatewayEnhancedVpnGatewaysResultOutput

    > Note: This function is named GetGatewayEnhancedVpnGateways in the Go SDK.

    public static class GetGatewayEnhancedVpnGateways 
{
    public static Task<GetGatewayEnhancedVpnGatewaysResult> InvokeAsync(GetGatewayEnhancedVpnGatewaysArgs args, InvokeOptions? opts = null)
    public static Output<GetGatewayEnhancedVpnGatewaysResult> Invoke(GetGatewayEnhancedVpnGatewaysInvokeArgs args, InvokeOptions? opts = null)
}
    public static CompletableFuture<GetGatewayEnhancedVpnGatewaysResult> getGatewayEnhancedVpnGateways(GetGatewayEnhancedVpnGatewaysArgs args, InvokeOptions options)
public static Output<GetGatewayEnhancedVpnGatewaysResult> getGatewayEnhancedVpnGateways(GetGatewayEnhancedVpnGatewaysArgs args, InvokeOptions options)

    fn::invoke:
  function: alicloud:vpn/getGatewayEnhancedVpnGateways:getGatewayEnhancedVpnGateways
  arguments:
    # arguments dictionary
    data "alicloud_vpn_getgatewayenhancedvpngateways" "name" {
    # arguments
}

    The following arguments are supported:

    EnableDetails bool
    Default to false. Set it to true to query detailed attributes.
    Ids List<string>
    A list of Enhanced Vpn Gateway IDs.
    OutputFile string
    File name where to save data source results (after running pulumi preview).
    Status string
    The status of the resource
    VpcId string
    The ID of the VPC to which the VPN gateway belongs.
    VpnInstanceId string
    The ID of the VPN gateway.
    EnableDetails bool
    Default to false. Set it to true to query detailed attributes.
    Ids []string
    A list of Enhanced Vpn Gateway IDs.
    OutputFile string
    File name where to save data source results (after running pulumi preview).
    Status string
    The status of the resource
    VpcId string
    The ID of the VPC to which the VPN gateway belongs.
    VpnInstanceId string
    The ID of the VPN gateway.
    enable_details bool
    Default to false. Set it to true to query detailed attributes.
    ids list(string)
    A list of Enhanced Vpn Gateway IDs.
    output_file string
    File name where to save data source results (after running pulumi preview).
    status string
    The status of the resource
    vpc_id string
    The ID of the VPC to which the VPN gateway belongs.
    vpn_instance_id string
    The ID of the VPN gateway.
    enableDetails Boolean
    Default to false. Set it to true to query detailed attributes.
    ids List<String>
    A list of Enhanced Vpn Gateway IDs.
    outputFile String
    File name where to save data source results (after running pulumi preview).
    status String
    The status of the resource
    vpcId String
    The ID of the VPC to which the VPN gateway belongs.
    vpnInstanceId String
    The ID of the VPN gateway.
    enableDetails boolean
    Default to false. Set it to true to query detailed attributes.
    ids string[]
    A list of Enhanced Vpn Gateway IDs.
    outputFile string
    File name where to save data source results (after running pulumi preview).
    status string
    The status of the resource
    vpcId string
    The ID of the VPC to which the VPN gateway belongs.
    vpnInstanceId string
    The ID of the VPN gateway.
    enable_details bool
    Default to false. Set it to true to query detailed attributes.
    ids Sequence[str]
    A list of Enhanced Vpn Gateway IDs.
    output_file str
    File name where to save data source results (after running pulumi preview).
    status str
    The status of the resource
    vpc_id str
    The ID of the VPC to which the VPN gateway belongs.
    vpn_instance_id str
    The ID of the VPN gateway.
    enableDetails Boolean
    Default to false. Set it to true to query detailed attributes.
    ids List<String>
    A list of Enhanced Vpn Gateway IDs.
    outputFile String
    File name where to save data source results (after running pulumi preview).
    status String
    The status of the resource
    vpcId String
    The ID of the VPC to which the VPN gateway belongs.
    vpnInstanceId String
    The ID of the VPN gateway.

    getGatewayEnhancedVpnGateways Result

    The following output properties are available:

    Gateways List<Pulumi.AliCloud.Vpn.Outputs.GetGatewayEnhancedVpnGatewaysGateway>
    A list of Enhanced Vpn Gateway Entries. Each element contains the following attributes:
    Id string
    The provider-assigned unique ID for this managed resource.
    Ids List<string>
    A list of Enhanced Vpn Gateway IDs.
    EnableDetails bool
    OutputFile string
    Status string
    The status of the resource.
    VpcId string
    The ID of the VPC to which the VPN gateway belongs.
    VpnInstanceId string
    The ID of the VPN gateway.
    Gateways []GetGatewayEnhancedVpnGatewaysGateway
    A list of Enhanced Vpn Gateway Entries. Each element contains the following attributes:
    Id string
    The provider-assigned unique ID for this managed resource.
    Ids []string
    A list of Enhanced Vpn Gateway IDs.
    EnableDetails bool
    OutputFile string
    Status string
    The status of the resource.
    VpcId string
    The ID of the VPC to which the VPN gateway belongs.
    VpnInstanceId string
    The ID of the VPN gateway.
    gateways list(object)
    A list of Enhanced Vpn Gateway Entries. Each element contains the following attributes:
    id string
    The provider-assigned unique ID for this managed resource.
    ids list(string)
    A list of Enhanced Vpn Gateway IDs.
    enable_details bool
    output_file string
    status string
    The status of the resource.
    vpc_id string
    The ID of the VPC to which the VPN gateway belongs.
    vpn_instance_id string
    The ID of the VPN gateway.
    gateways List<GetGatewayEnhancedVpnGatewaysGateway>
    A list of Enhanced Vpn Gateway Entries. Each element contains the following attributes:
    id String
    The provider-assigned unique ID for this managed resource.
    ids List<String>
    A list of Enhanced Vpn Gateway IDs.
    enableDetails Boolean
    outputFile String
    status String
    The status of the resource.
    vpcId String
    The ID of the VPC to which the VPN gateway belongs.
    vpnInstanceId String
    The ID of the VPN gateway.
    gateways GetGatewayEnhancedVpnGatewaysGateway[]
    A list of Enhanced Vpn Gateway Entries. Each element contains the following attributes:
    id string
    The provider-assigned unique ID for this managed resource.
    ids string[]
    A list of Enhanced Vpn Gateway IDs.
    enableDetails boolean
    outputFile string
    status string
    The status of the resource.
    vpcId string
    The ID of the VPC to which the VPN gateway belongs.
    vpnInstanceId string
    The ID of the VPN gateway.
    gateways Sequence[GetGatewayEnhancedVpnGatewaysGateway]
    A list of Enhanced Vpn Gateway Entries. Each element contains the following attributes:
    id str
    The provider-assigned unique ID for this managed resource.
    ids Sequence[str]
    A list of Enhanced Vpn Gateway IDs.
    enable_details bool
    output_file str
    status str
    The status of the resource.
    vpc_id str
    The ID of the VPC to which the VPN gateway belongs.
    vpn_instance_id str
    The ID of the VPN gateway.
    gateways List<Property Map>
    A list of Enhanced Vpn Gateway Entries. Each element contains the following attributes:
    id String
    The provider-assigned unique ID for this managed resource.
    ids List<String>
    A list of Enhanced Vpn Gateway IDs.
    enableDetails Boolean
    outputFile String
    status String
    The status of the resource.
    vpcId String
    The ID of the VPC to which the VPN gateway belongs.
    vpnInstanceId String
    The ID of the VPN gateway.

    Supporting Types

    GetGatewayEnhancedVpnGatewaysGateway

    AutoPropagate bool
    Specifies whether to automatically propagate BGP routes to the VPC.
    CreateTime int
    The time when the VPN gateway was created.
    Description string
    The description of the VPN gateway.
    DisasterRecoveryVswitchId string
    The ID of the backup VSwitch to which the VPN gateway is attached.
    GatewayType string
    VPN gateway type.
    Id string
    The ID of the resource supplied above.
    NetworkType string
    Type of Gateway.
    Status string
    The status of the resource
    Tags Dictionary<string, string>
    The Tag of.
    VpcId string
    The ID of the VPC to which the VPN gateway belongs.
    VpnGatewayName string
    The name of the VPN gateway.
    VpnInstanceId string
    The ID of the VPN gateway.
    VpnType string
    The Type of Vpn.
    VswitchId string
    The ID of the VSwitch to which the VPN gateway is attached.
    AutoPropagate bool
    Specifies whether to automatically propagate BGP routes to the VPC.
    CreateTime int
    The time when the VPN gateway was created.
    Description string
    The description of the VPN gateway.
    DisasterRecoveryVswitchId string
    The ID of the backup VSwitch to which the VPN gateway is attached.
    GatewayType string
    VPN gateway type.
    Id string
    The ID of the resource supplied above.
    NetworkType string
    Type of Gateway.
    Status string
    The status of the resource
    Tags map[string]string
    The Tag of.
    VpcId string
    The ID of the VPC to which the VPN gateway belongs.
    VpnGatewayName string
    The name of the VPN gateway.
    VpnInstanceId string
    The ID of the VPN gateway.
    VpnType string
    The Type of Vpn.
    VswitchId string
    The ID of the VSwitch to which the VPN gateway is attached.
    auto_propagate bool
    Specifies whether to automatically propagate BGP routes to the VPC.
    create_time number
    The time when the VPN gateway was created.
    description string
    The description of the VPN gateway.
    disaster_recovery_vswitch_id string
    The ID of the backup VSwitch to which the VPN gateway is attached.
    gateway_type string
    VPN gateway type.
    id string
    The ID of the resource supplied above.
    network_type string
    Type of Gateway.
    status string
    The status of the resource
    tags map(string)
    The Tag of.
    vpc_id string
    The ID of the VPC to which the VPN gateway belongs.
    vpn_gateway_name string
    The name of the VPN gateway.
    vpn_instance_id string
    The ID of the VPN gateway.
    vpn_type string
    The Type of Vpn.
    vswitch_id string
    The ID of the VSwitch to which the VPN gateway is attached.
    autoPropagate Boolean
    Specifies whether to automatically propagate BGP routes to the VPC.
    createTime Integer
    The time when the VPN gateway was created.
    description String
    The description of the VPN gateway.
    disasterRecoveryVswitchId String
    The ID of the backup VSwitch to which the VPN gateway is attached.
    gatewayType String
    VPN gateway type.
    id String
    The ID of the resource supplied above.
    networkType String
    Type of Gateway.
    status String
    The status of the resource
    tags Map<String,String>
    The Tag of.
    vpcId String
    The ID of the VPC to which the VPN gateway belongs.
    vpnGatewayName String
    The name of the VPN gateway.
    vpnInstanceId String
    The ID of the VPN gateway.
    vpnType String
    The Type of Vpn.
    vswitchId String
    The ID of the VSwitch to which the VPN gateway is attached.
    autoPropagate boolean
    Specifies whether to automatically propagate BGP routes to the VPC.
    createTime number
    The time when the VPN gateway was created.
    description string
    The description of the VPN gateway.
    disasterRecoveryVswitchId string
    The ID of the backup VSwitch to which the VPN gateway is attached.
    gatewayType string
    VPN gateway type.
    id string
    The ID of the resource supplied above.
    networkType string
    Type of Gateway.
    status string
    The status of the resource
    tags {[key: string]: string}
    The Tag of.
    vpcId string
    The ID of the VPC to which the VPN gateway belongs.
    vpnGatewayName string
    The name of the VPN gateway.
    vpnInstanceId string
    The ID of the VPN gateway.
    vpnType string
    The Type of Vpn.
    vswitchId string
    The ID of the VSwitch to which the VPN gateway is attached.
    auto_propagate bool
    Specifies whether to automatically propagate BGP routes to the VPC.
    create_time int
    The time when the VPN gateway was created.
    description str
    The description of the VPN gateway.
    disaster_recovery_vswitch_id str
    The ID of the backup VSwitch to which the VPN gateway is attached.
    gateway_type str
    VPN gateway type.
    id str
    The ID of the resource supplied above.
    network_type str
    Type of Gateway.
    status str
    The status of the resource
    tags Mapping[str, str]
    The Tag of.
    vpc_id str
    The ID of the VPC to which the VPN gateway belongs.
    vpn_gateway_name str
    The name of the VPN gateway.
    vpn_instance_id str
    The ID of the VPN gateway.
    vpn_type str
    The Type of Vpn.
    vswitch_id str
    The ID of the VSwitch to which the VPN gateway is attached.
    autoPropagate Boolean
    Specifies whether to automatically propagate BGP routes to the VPC.
    createTime Number
    The time when the VPN gateway was created.
    description String
    The description of the VPN gateway.
    disasterRecoveryVswitchId String
    The ID of the backup VSwitch to which the VPN gateway is attached.
    gatewayType String
    VPN gateway type.
    id String
    The ID of the resource supplied above.
    networkType String
    Type of Gateway.
    status String
    The status of the resource
    tags Map<String>
    The Tag of.
    vpcId String
    The ID of the VPC to which the VPN gateway belongs.
    vpnGatewayName String
    The name of the VPN gateway.
    vpnInstanceId String
    The ID of the VPN gateway.
    vpnType String
    The Type of Vpn.
    vswitchId String
    The ID of the VSwitch to which the VPN gateway is attached.

    Package Details

    Repository
    Alibaba Cloud pulumi/pulumi-alicloud
    License
    Apache-2.0
    Notes
    This Pulumi package is based on the alicloud Terraform Provider.
    alicloud logo
    Viewing docs for Alibaba Cloud v3.104.0
    published on Thursday, Jun 25, 2026 by Pulumi
    Schema (JSON)
    pulumi/pulumi-alicloud

      Try Pulumi Cloud free.
      Your team will thank you.

      Start free trial