1. Packages
  2. Packages
  3. Fortimanager Provider
  4. API Docs
  5. ObjectFirewallDecryptedtrafficmirror
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev

    Configure decrypted traffic mirror.

    Example Usage

    import * as pulumi from "@pulumi/pulumi";
    import * as fortimanager from "@pulumi/fortimanager";
    
    const trname = new fortimanager.ObjectFirewallDecryptedtrafficmirror("trname", {
        dstmac: "ff:ff:ff:ff:ff:ff",
        "interface": "any",
        name: "terr-firewall-mirror",
        trafficSource: "both",
        trafficTypes: [
            "ssh",
            "ssl",
        ],
    });
    
    import pulumi
    import pulumi_fortimanager as fortimanager
    
    trname = fortimanager.ObjectFirewallDecryptedtrafficmirror("trname",
        dstmac="ff:ff:ff:ff:ff:ff",
        interface="any",
        name="terr-firewall-mirror",
        traffic_source="both",
        traffic_types=[
            "ssh",
            "ssl",
        ])
    
    package main
    
    import (
    	"github.com/pulumi/pulumi-terraform-provider/sdks/go/fortimanager/fortimanager"
    	"github.com/pulumi/pulumi/sdk/v3/go/pulumi"
    )
    
    func main() {
    	pulumi.Run(func(ctx *pulumi.Context) error {
    		_, err := fortimanager.NewObjectFirewallDecryptedtrafficmirror(ctx, "trname", &fortimanager.ObjectFirewallDecryptedtrafficmirrorArgs{
    			Dstmac:        pulumi.String("ff:ff:ff:ff:ff:ff"),
    			Interface:     pulumi.String("any"),
    			Name:          pulumi.String("terr-firewall-mirror"),
    			TrafficSource: pulumi.String("both"),
    			TrafficTypes: pulumi.StringArray{
    				pulumi.String("ssh"),
    				pulumi.String("ssl"),
    			},
    		})
    		if err != nil {
    			return err
    		}
    		return nil
    	})
    }
    
    using System.Collections.Generic;
    using System.Linq;
    using Pulumi;
    using Fortimanager = Pulumi.Fortimanager;
    
    return await Deployment.RunAsync(() => 
    {
        var trname = new Fortimanager.ObjectFirewallDecryptedtrafficmirror("trname", new()
        {
            Dstmac = "ff:ff:ff:ff:ff:ff",
            Interface = "any",
            Name = "terr-firewall-mirror",
            TrafficSource = "both",
            TrafficTypes = new[]
            {
                "ssh",
                "ssl",
            },
        });
    
    });
    
    package generated_program;
    
    import com.pulumi.Context;
    import com.pulumi.Pulumi;
    import com.pulumi.core.Output;
    import com.pulumi.fortimanager.ObjectFirewallDecryptedtrafficmirror;
    import com.pulumi.fortimanager.ObjectFirewallDecryptedtrafficmirrorArgs;
    import java.util.List;
    import java.util.ArrayList;
    import java.util.Map;
    import java.io.File;
    import java.nio.file.Files;
    import java.nio.file.Paths;
    
    public class App {
        public static void main(String[] args) {
            Pulumi.run(App::stack);
        }
    
        public static void stack(Context ctx) {
            var trname = new ObjectFirewallDecryptedtrafficmirror("trname", ObjectFirewallDecryptedtrafficmirrorArgs.builder()
                .dstmac("ff:ff:ff:ff:ff:ff")
                .interface_("any")
                .name("terr-firewall-mirror")
                .trafficSource("both")
                .trafficTypes(            
                    "ssh",
                    "ssl")
                .build());
    
        }
    }
    
    resources:
      trname:
        type: fortimanager:ObjectFirewallDecryptedtrafficmirror
        properties:
          dstmac: ff:ff:ff:ff:ff:ff
          interface: any
          name: terr-firewall-mirror
          trafficSource: both
          trafficTypes:
            - ssh
            - ssl
    
    Example coming soon!
    

    Create ObjectFirewallDecryptedtrafficmirror Resource

    Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.

    Constructor syntax

    new ObjectFirewallDecryptedtrafficmirror(name: string, args?: ObjectFirewallDecryptedtrafficmirrorArgs, opts?: CustomResourceOptions);
    @overload
    def ObjectFirewallDecryptedtrafficmirror(resource_name: str,
                                             args: Optional[ObjectFirewallDecryptedtrafficmirrorArgs] = None,
                                             opts: Optional[ResourceOptions] = None)
    
    @overload
    def ObjectFirewallDecryptedtrafficmirror(resource_name: str,
                                             opts: Optional[ResourceOptions] = None,
                                             adom: Optional[str] = None,
                                             dstmac: Optional[str] = None,
                                             interface: Optional[str] = None,
                                             name: Optional[str] = None,
                                             object_firewall_decryptedtrafficmirror_id: Optional[str] = None,
                                             scopetype: Optional[str] = None,
                                             traffic_source: Optional[str] = None,
                                             traffic_types: Optional[Sequence[str]] = None,
                                             update_if_exist: Optional[bool] = None)
    func NewObjectFirewallDecryptedtrafficmirror(ctx *Context, name string, args *ObjectFirewallDecryptedtrafficmirrorArgs, opts ...ResourceOption) (*ObjectFirewallDecryptedtrafficmirror, error)
    public ObjectFirewallDecryptedtrafficmirror(string name, ObjectFirewallDecryptedtrafficmirrorArgs? args = null, CustomResourceOptions? opts = null)
    public ObjectFirewallDecryptedtrafficmirror(String name, ObjectFirewallDecryptedtrafficmirrorArgs args)
    public ObjectFirewallDecryptedtrafficmirror(String name, ObjectFirewallDecryptedtrafficmirrorArgs args, CustomResourceOptions options)
    
    type: fortimanager:ObjectFirewallDecryptedtrafficmirror
    properties: # The arguments to resource properties.
    options: # Bag of options to control resource's behavior.
    
    
    resource "fortimanager_objectfirewalldecryptedtrafficmirror" "name" {
        # resource properties
    }

    Parameters

    name string
    The unique name of the resource.
    args ObjectFirewallDecryptedtrafficmirrorArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    resource_name str
    The unique name of the resource.
    args ObjectFirewallDecryptedtrafficmirrorArgs
    The arguments to resource properties.
    opts ResourceOptions
    Bag of options to control resource's behavior.
    ctx Context
    Context object for the current deployment.
    name string
    The unique name of the resource.
    args ObjectFirewallDecryptedtrafficmirrorArgs
    The arguments to resource properties.
    opts ResourceOption
    Bag of options to control resource's behavior.
    name string
    The unique name of the resource.
    args ObjectFirewallDecryptedtrafficmirrorArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    name String
    The unique name of the resource.
    args ObjectFirewallDecryptedtrafficmirrorArgs
    The arguments to resource properties.
    options CustomResourceOptions
    Bag of options to control resource's behavior.

    Constructor example

    The following reference example uses placeholder values for all input properties.

    var objectFirewallDecryptedtrafficmirrorResource = new Fortimanager.ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource", new()
    {
        Adom = "string",
        Dstmac = "string",
        Interface = "string",
        Name = "string",
        ObjectFirewallDecryptedtrafficmirrorId = "string",
        Scopetype = "string",
        TrafficSource = "string",
        TrafficTypes = new[]
        {
            "string",
        },
        UpdateIfExist = false,
    });
    
    example, err := fortimanager.NewObjectFirewallDecryptedtrafficmirror(ctx, "objectFirewallDecryptedtrafficmirrorResource", &fortimanager.ObjectFirewallDecryptedtrafficmirrorArgs{
    	Adom:                                   pulumi.String("string"),
    	Dstmac:                                 pulumi.String("string"),
    	Interface:                              pulumi.String("string"),
    	Name:                                   pulumi.String("string"),
    	ObjectFirewallDecryptedtrafficmirrorId: pulumi.String("string"),
    	Scopetype:                              pulumi.String("string"),
    	TrafficSource:                          pulumi.String("string"),
    	TrafficTypes: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	UpdateIfExist: pulumi.Bool(false),
    })
    
    resource "fortimanager_objectfirewalldecryptedtrafficmirror" "objectFirewallDecryptedtrafficmirrorResource" {
      adom                                      = "string"
      dstmac                                    = "string"
      interface                                 = "string"
      name                                      = "string"
      object_firewall_decryptedtrafficmirror_id = "string"
      scopetype                                 = "string"
      traffic_source                            = "string"
      traffic_types                             = ["string"]
      update_if_exist                           = false
    }
    
    var objectFirewallDecryptedtrafficmirrorResource = new ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource", ObjectFirewallDecryptedtrafficmirrorArgs.builder()
        .adom("string")
        .dstmac("string")
        .interface_("string")
        .name("string")
        .objectFirewallDecryptedtrafficmirrorId("string")
        .scopetype("string")
        .trafficSource("string")
        .trafficTypes("string")
        .updateIfExist(false)
        .build());
    
    object_firewall_decryptedtrafficmirror_resource = fortimanager.ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource",
        adom="string",
        dstmac="string",
        interface="string",
        name="string",
        object_firewall_decryptedtrafficmirror_id="string",
        scopetype="string",
        traffic_source="string",
        traffic_types=["string"],
        update_if_exist=False)
    
    const objectFirewallDecryptedtrafficmirrorResource = new fortimanager.ObjectFirewallDecryptedtrafficmirror("objectFirewallDecryptedtrafficmirrorResource", {
        adom: "string",
        dstmac: "string",
        "interface": "string",
        name: "string",
        objectFirewallDecryptedtrafficmirrorId: "string",
        scopetype: "string",
        trafficSource: "string",
        trafficTypes: ["string"],
        updateIfExist: false,
    });
    
    type: fortimanager:ObjectFirewallDecryptedtrafficmirror
    properties:
        adom: string
        dstmac: string
        interface: string
        name: string
        objectFirewallDecryptedtrafficmirrorId: string
        scopetype: string
        trafficSource: string
        trafficTypes:
            - string
        updateIfExist: false
    

    ObjectFirewallDecryptedtrafficmirror Resource Properties

    To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.

    Inputs

    In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.

    The ObjectFirewallDecryptedtrafficmirror resource accepts the following input properties:

    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Dstmac string
    Set destination MAC address for mirrored traffic.
    Interface string
    Decrypted traffic mirror interface
    Name string
    Name.
    ObjectFirewallDecryptedtrafficmirrorId string
    an identifier for the resource with format {{name}}.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    TrafficSource string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    TrafficTypes List<string>
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    UpdateIfExist bool
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Dstmac string
    Set destination MAC address for mirrored traffic.
    Interface string
    Decrypted traffic mirror interface
    Name string
    Name.
    ObjectFirewallDecryptedtrafficmirrorId string
    an identifier for the resource with format {{name}}.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    TrafficSource string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    TrafficTypes []string
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    UpdateIfExist bool
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac string
    Set destination MAC address for mirrored traffic.
    interface string
    Decrypted traffic mirror interface
    name string
    Name.
    object_firewall_decryptedtrafficmirror_id string
    an identifier for the resource with format {{name}}.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    traffic_source string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    traffic_types list(string)
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    update_if_exist bool
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac String
    Set destination MAC address for mirrored traffic.
    interface_ String
    Decrypted traffic mirror interface
    name String
    Name.
    objectFirewallDecryptedtrafficmirrorId String
    an identifier for the resource with format {{name}}.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    trafficSource String
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    trafficTypes List<String>
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    updateIfExist Boolean
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac string
    Set destination MAC address for mirrored traffic.
    interface string
    Decrypted traffic mirror interface
    name string
    Name.
    objectFirewallDecryptedtrafficmirrorId string
    an identifier for the resource with format {{name}}.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    trafficSource string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    trafficTypes string[]
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    updateIfExist boolean
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac str
    Set destination MAC address for mirrored traffic.
    interface str
    Decrypted traffic mirror interface
    name str
    Name.
    object_firewall_decryptedtrafficmirror_id str
    an identifier for the resource with format {{name}}.
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    traffic_source str
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    traffic_types Sequence[str]
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    update_if_exist bool
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac String
    Set destination MAC address for mirrored traffic.
    interface String
    Decrypted traffic mirror interface
    name String
    Name.
    objectFirewallDecryptedtrafficmirrorId String
    an identifier for the resource with format {{name}}.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    trafficSource String
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    trafficTypes List<String>
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    updateIfExist Boolean

    Outputs

    All input properties are implicitly available as output properties. Additionally, the ObjectFirewallDecryptedtrafficmirror resource produces the following output properties:

    Id string
    The provider-assigned unique ID for this managed resource.
    Id string
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id str
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.

    Look up Existing ObjectFirewallDecryptedtrafficmirror Resource

    Get an existing ObjectFirewallDecryptedtrafficmirror resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.

    public static get(name: string, id: Input<ID>, state?: ObjectFirewallDecryptedtrafficmirrorState, opts?: CustomResourceOptions): ObjectFirewallDecryptedtrafficmirror
    @staticmethod
    def get(resource_name: str,
            id: str,
            opts: Optional[ResourceOptions] = None,
            adom: Optional[str] = None,
            dstmac: Optional[str] = None,
            interface: Optional[str] = None,
            name: Optional[str] = None,
            object_firewall_decryptedtrafficmirror_id: Optional[str] = None,
            scopetype: Optional[str] = None,
            traffic_source: Optional[str] = None,
            traffic_types: Optional[Sequence[str]] = None,
            update_if_exist: Optional[bool] = None) -> ObjectFirewallDecryptedtrafficmirror
    func GetObjectFirewallDecryptedtrafficmirror(ctx *Context, name string, id IDInput, state *ObjectFirewallDecryptedtrafficmirrorState, opts ...ResourceOption) (*ObjectFirewallDecryptedtrafficmirror, error)
    public static ObjectFirewallDecryptedtrafficmirror Get(string name, Input<string> id, ObjectFirewallDecryptedtrafficmirrorState? state, CustomResourceOptions? opts = null)
    public static ObjectFirewallDecryptedtrafficmirror get(String name, Output<String> id, ObjectFirewallDecryptedtrafficmirrorState state, CustomResourceOptions options)
    resources:  _:    type: fortimanager:ObjectFirewallDecryptedtrafficmirror    get:      id: ${id}
    import {
      to = fortimanager_objectfirewalldecryptedtrafficmirror.example
      id = "${id}"
    }
    
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    resource_name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    The following state arguments are supported:
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Dstmac string
    Set destination MAC address for mirrored traffic.
    Interface string
    Decrypted traffic mirror interface
    Name string
    Name.
    ObjectFirewallDecryptedtrafficmirrorId string
    an identifier for the resource with format {{name}}.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    TrafficSource string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    TrafficTypes List<string>
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    UpdateIfExist bool
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Dstmac string
    Set destination MAC address for mirrored traffic.
    Interface string
    Decrypted traffic mirror interface
    Name string
    Name.
    ObjectFirewallDecryptedtrafficmirrorId string
    an identifier for the resource with format {{name}}.
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    TrafficSource string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    TrafficTypes []string
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    UpdateIfExist bool
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac string
    Set destination MAC address for mirrored traffic.
    interface string
    Decrypted traffic mirror interface
    name string
    Name.
    object_firewall_decryptedtrafficmirror_id string
    an identifier for the resource with format {{name}}.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    traffic_source string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    traffic_types list(string)
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    update_if_exist bool
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac String
    Set destination MAC address for mirrored traffic.
    interface_ String
    Decrypted traffic mirror interface
    name String
    Name.
    objectFirewallDecryptedtrafficmirrorId String
    an identifier for the resource with format {{name}}.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    trafficSource String
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    trafficTypes List<String>
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    updateIfExist Boolean
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac string
    Set destination MAC address for mirrored traffic.
    interface string
    Decrypted traffic mirror interface
    name string
    Name.
    objectFirewallDecryptedtrafficmirrorId string
    an identifier for the resource with format {{name}}.
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    trafficSource string
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    trafficTypes string[]
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    updateIfExist boolean
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac str
    Set destination MAC address for mirrored traffic.
    interface str
    Decrypted traffic mirror interface
    name str
    Name.
    object_firewall_decryptedtrafficmirror_id str
    an identifier for the resource with format {{name}}.
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    traffic_source str
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    traffic_types Sequence[str]
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    update_if_exist bool
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    dstmac String
    Set destination MAC address for mirrored traffic.
    interface String
    Decrypted traffic mirror interface
    name String
    Name.
    objectFirewallDecryptedtrafficmirrorId String
    an identifier for the resource with format {{name}}.
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom, global. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    trafficSource String
    Source of decrypted traffic to be mirrored. Valid values: client, server, both.
    trafficTypes List<String>
    Types of decrypted traffic to be mirrored. Valid values: ssl, ssh.
    updateIfExist Boolean

    Import

    ObjectFirewall DecryptedTrafficMirror can be imported using any of these accepted formats:

    $ export “FORTIMANAGER_IMPORT_TABLE”=“true”

    $ pulumi import fortimanager:index/objectFirewallDecryptedtrafficmirror:ObjectFirewallDecryptedtrafficmirror labelname {{name}}
    

    $ unset “FORTIMANAGER_IMPORT_TABLE”

    -> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.

    To learn more about importing existing cloud resources, see Importing resources.

    Package Details

    Repository
    fortimanager fortinetdev/terraform-provider-fortimanager
    License
    Notes
    This Pulumi package is based on the fortimanager Terraform Provider.
    Viewing docs for fortimanager 1.17.0
    published on Monday, May 4, 2026 by fortinetdev
      Try Pulumi Cloud free. Your team will thank you.