1. Packages
  2. Packages
  3. Fortimanager Provider
  4. API Docs
  5. PackagesFirewallCentralsnatmap
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev
Viewing docs for fortimanager 1.17.0
published on Monday, May 4, 2026 by fortinetdev

    Configure central SNAT policies.

    Example Usage

    import * as pulumi from "@pulumi/pulumi";
    import * as fortimanager from "@pulumi/fortimanager";
    
    const labelname = new fortimanager.PackagesFirewallCentralsnatmap("labelname", {
        pkg: "default",
        nat: "enable",
        natPort: "0",
        origPort: "0",
        policyid: 1,
        protocol: 33,
        status: "enable",
        dstAddrs: ["all"],
        dstintfs: ["port3"],
        origAddrs: ["all"],
        srcintfs: ["port1"],
    });
    
    import pulumi
    import pulumi_fortimanager as fortimanager
    
    labelname = fortimanager.PackagesFirewallCentralsnatmap("labelname",
        pkg="default",
        nat="enable",
        nat_port="0",
        orig_port="0",
        policyid=1,
        protocol=33,
        status="enable",
        dst_addrs=["all"],
        dstintfs=["port3"],
        orig_addrs=["all"],
        srcintfs=["port1"])
    
    package main
    
    import (
    	"github.com/pulumi/pulumi-terraform-provider/sdks/go/fortimanager/fortimanager"
    	"github.com/pulumi/pulumi/sdk/v3/go/pulumi"
    )
    
    func main() {
    	pulumi.Run(func(ctx *pulumi.Context) error {
    		_, err := fortimanager.NewPackagesFirewallCentralsnatmap(ctx, "labelname", &fortimanager.PackagesFirewallCentralsnatmapArgs{
    			Pkg:      pulumi.String("default"),
    			Nat:      pulumi.String("enable"),
    			NatPort:  pulumi.String("0"),
    			OrigPort: pulumi.String("0"),
    			Policyid: pulumi.Float64(1),
    			Protocol: pulumi.Float64(33),
    			Status:   pulumi.String("enable"),
    			DstAddrs: pulumi.StringArray{
    				pulumi.String("all"),
    			},
    			Dstintfs: pulumi.StringArray{
    				pulumi.String("port3"),
    			},
    			OrigAddrs: pulumi.StringArray{
    				pulumi.String("all"),
    			},
    			Srcintfs: pulumi.StringArray{
    				pulumi.String("port1"),
    			},
    		})
    		if err != nil {
    			return err
    		}
    		return nil
    	})
    }
    
    using System.Collections.Generic;
    using System.Linq;
    using Pulumi;
    using Fortimanager = Pulumi.Fortimanager;
    
    return await Deployment.RunAsync(() => 
    {
        var labelname = new Fortimanager.PackagesFirewallCentralsnatmap("labelname", new()
        {
            Pkg = "default",
            Nat = "enable",
            NatPort = "0",
            OrigPort = "0",
            Policyid = 1,
            Protocol = 33,
            Status = "enable",
            DstAddrs = new[]
            {
                "all",
            },
            Dstintfs = new[]
            {
                "port3",
            },
            OrigAddrs = new[]
            {
                "all",
            },
            Srcintfs = new[]
            {
                "port1",
            },
        });
    
    });
    
    package generated_program;
    
    import com.pulumi.Context;
    import com.pulumi.Pulumi;
    import com.pulumi.core.Output;
    import com.pulumi.fortimanager.PackagesFirewallCentralsnatmap;
    import com.pulumi.fortimanager.PackagesFirewallCentralsnatmapArgs;
    import java.util.List;
    import java.util.ArrayList;
    import java.util.Map;
    import java.io.File;
    import java.nio.file.Files;
    import java.nio.file.Paths;
    
    public class App {
        public static void main(String[] args) {
            Pulumi.run(App::stack);
        }
    
        public static void stack(Context ctx) {
            var labelname = new PackagesFirewallCentralsnatmap("labelname", PackagesFirewallCentralsnatmapArgs.builder()
                .pkg("default")
                .nat("enable")
                .natPort("0")
                .origPort("0")
                .policyid(1.0)
                .protocol(33.0)
                .status("enable")
                .dstAddrs("all")
                .dstintfs("port3")
                .origAddrs("all")
                .srcintfs("port1")
                .build());
    
        }
    }
    
    resources:
      labelname:
        type: fortimanager:PackagesFirewallCentralsnatmap
        properties:
          pkg: default
          nat: enable
          natPort: '0'
          origPort: '0'
          policyid: 1
          protocol: 33
          status: enable
          dstAddrs:
            - all
          dstintfs:
            - port3
          origAddrs:
            - all
          srcintfs:
            - port1
    
    Example coming soon!
    

    Create PackagesFirewallCentralsnatmap Resource

    Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.

    Constructor syntax

    new PackagesFirewallCentralsnatmap(name: string, args: PackagesFirewallCentralsnatmapArgs, opts?: CustomResourceOptions);
    @overload
    def PackagesFirewallCentralsnatmap(resource_name: str,
                                       args: PackagesFirewallCentralsnatmapArgs,
                                       opts: Optional[ResourceOptions] = None)
    
    @overload
    def PackagesFirewallCentralsnatmap(resource_name: str,
                                       opts: Optional[ResourceOptions] = None,
                                       pkg: Optional[str] = None,
                                       orig_port: Optional[str] = None,
                                       packages_firewall_centralsnatmap_id: Optional[str] = None,
                                       dst_addr6: Optional[str] = None,
                                       dst_addrs: Optional[Sequence[str]] = None,
                                       dst_port: Optional[str] = None,
                                       dstintfs: Optional[Sequence[str]] = None,
                                       ipv6: Optional[str] = None,
                                       nat: Optional[str] = None,
                                       nat46: Optional[str] = None,
                                       nat64: Optional[str] = None,
                                       nat_ippool6s: Optional[Sequence[str]] = None,
                                       nat_ippools: Optional[Sequence[str]] = None,
                                       nat_port: Optional[str] = None,
                                       orig_addr6: Optional[str] = None,
                                       comments: Optional[str] = None,
                                       orig_addrs: Optional[Sequence[str]] = None,
                                       pkg_folder_path: Optional[str] = None,
                                       adom: Optional[str] = None,
                                       action: Optional[str] = None,
                                       policyid: Optional[float] = None,
                                       port_preserve: Optional[str] = None,
                                       port_random: Optional[str] = None,
                                       protocol: Optional[float] = None,
                                       scopetype: Optional[str] = None,
                                       src_addr6s: Optional[Sequence[str]] = None,
                                       src_addrs: Optional[Sequence[str]] = None,
                                       srcintfs: Optional[Sequence[str]] = None,
                                       status: Optional[str] = None,
                                       type: Optional[str] = None,
                                       update_if_exist: Optional[bool] = None,
                                       uuid: Optional[str] = None)
    func NewPackagesFirewallCentralsnatmap(ctx *Context, name string, args PackagesFirewallCentralsnatmapArgs, opts ...ResourceOption) (*PackagesFirewallCentralsnatmap, error)
    public PackagesFirewallCentralsnatmap(string name, PackagesFirewallCentralsnatmapArgs args, CustomResourceOptions? opts = null)
    public PackagesFirewallCentralsnatmap(String name, PackagesFirewallCentralsnatmapArgs args)
    public PackagesFirewallCentralsnatmap(String name, PackagesFirewallCentralsnatmapArgs args, CustomResourceOptions options)
    
    type: fortimanager:PackagesFirewallCentralsnatmap
    properties: # The arguments to resource properties.
    options: # Bag of options to control resource's behavior.
    
    
    resource "fortimanager_packagesfirewallcentralsnatmap" "name" {
        # resource properties
    }

    Parameters

    name string
    The unique name of the resource.
    args PackagesFirewallCentralsnatmapArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    resource_name str
    The unique name of the resource.
    args PackagesFirewallCentralsnatmapArgs
    The arguments to resource properties.
    opts ResourceOptions
    Bag of options to control resource's behavior.
    ctx Context
    Context object for the current deployment.
    name string
    The unique name of the resource.
    args PackagesFirewallCentralsnatmapArgs
    The arguments to resource properties.
    opts ResourceOption
    Bag of options to control resource's behavior.
    name string
    The unique name of the resource.
    args PackagesFirewallCentralsnatmapArgs
    The arguments to resource properties.
    opts CustomResourceOptions
    Bag of options to control resource's behavior.
    name String
    The unique name of the resource.
    args PackagesFirewallCentralsnatmapArgs
    The arguments to resource properties.
    options CustomResourceOptions
    Bag of options to control resource's behavior.

    Constructor example

    The following reference example uses placeholder values for all input properties.

    var packagesFirewallCentralsnatmapResource = new Fortimanager.PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource", new()
    {
        Pkg = "string",
        OrigPort = "string",
        PackagesFirewallCentralsnatmapId = "string",
        DstAddr6 = "string",
        DstAddrs = new[]
        {
            "string",
        },
        DstPort = "string",
        Dstintfs = new[]
        {
            "string",
        },
        Ipv6 = "string",
        Nat = "string",
        Nat46 = "string",
        Nat64 = "string",
        NatIppool6s = new[]
        {
            "string",
        },
        NatIppools = new[]
        {
            "string",
        },
        NatPort = "string",
        OrigAddr6 = "string",
        Comments = "string",
        OrigAddrs = new[]
        {
            "string",
        },
        PkgFolderPath = "string",
        Adom = "string",
        Action = "string",
        Policyid = 0,
        PortPreserve = "string",
        PortRandom = "string",
        Protocol = 0,
        Scopetype = "string",
        SrcAddr6s = new[]
        {
            "string",
        },
        SrcAddrs = new[]
        {
            "string",
        },
        Srcintfs = new[]
        {
            "string",
        },
        Status = "string",
        Type = "string",
        UpdateIfExist = false,
        Uuid = "string",
    });
    
    example, err := fortimanager.NewPackagesFirewallCentralsnatmap(ctx, "packagesFirewallCentralsnatmapResource", &fortimanager.PackagesFirewallCentralsnatmapArgs{
    	Pkg:                              pulumi.String("string"),
    	OrigPort:                         pulumi.String("string"),
    	PackagesFirewallCentralsnatmapId: pulumi.String("string"),
    	DstAddr6:                         pulumi.String("string"),
    	DstAddrs: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	DstPort: pulumi.String("string"),
    	Dstintfs: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	Ipv6:  pulumi.String("string"),
    	Nat:   pulumi.String("string"),
    	Nat46: pulumi.String("string"),
    	Nat64: pulumi.String("string"),
    	NatIppool6s: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	NatIppools: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	NatPort:   pulumi.String("string"),
    	OrigAddr6: pulumi.String("string"),
    	Comments:  pulumi.String("string"),
    	OrigAddrs: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	PkgFolderPath: pulumi.String("string"),
    	Adom:          pulumi.String("string"),
    	Action:        pulumi.String("string"),
    	Policyid:      pulumi.Float64(0),
    	PortPreserve:  pulumi.String("string"),
    	PortRandom:    pulumi.String("string"),
    	Protocol:      pulumi.Float64(0),
    	Scopetype:     pulumi.String("string"),
    	SrcAddr6s: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	SrcAddrs: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	Srcintfs: pulumi.StringArray{
    		pulumi.String("string"),
    	},
    	Status:        pulumi.String("string"),
    	Type:          pulumi.String("string"),
    	UpdateIfExist: pulumi.Bool(false),
    	Uuid:          pulumi.String("string"),
    })
    
    resource "fortimanager_packagesfirewallcentralsnatmap" "packagesFirewallCentralsnatmapResource" {
      pkg                                 = "string"
      orig_port                           = "string"
      packages_firewall_centralsnatmap_id = "string"
      dst_addr6                           = "string"
      dst_addrs                           = ["string"]
      dst_port                            = "string"
      dstintfs                            = ["string"]
      ipv6                                = "string"
      nat                                 = "string"
      nat46                               = "string"
      nat64                               = "string"
      nat_ippool6s                        = ["string"]
      nat_ippools                         = ["string"]
      nat_port                            = "string"
      orig_addr6                          = "string"
      comments                            = "string"
      orig_addrs                          = ["string"]
      pkg_folder_path                     = "string"
      adom                                = "string"
      action                              = "string"
      policyid                            = 0
      port_preserve                       = "string"
      port_random                         = "string"
      protocol                            = 0
      scopetype                           = "string"
      src_addr6s                          = ["string"]
      src_addrs                           = ["string"]
      srcintfs                            = ["string"]
      status                              = "string"
      type                                = "string"
      update_if_exist                     = false
      uuid                                = "string"
    }
    
    var packagesFirewallCentralsnatmapResource = new PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource", PackagesFirewallCentralsnatmapArgs.builder()
        .pkg("string")
        .origPort("string")
        .packagesFirewallCentralsnatmapId("string")
        .dstAddr6("string")
        .dstAddrs("string")
        .dstPort("string")
        .dstintfs("string")
        .ipv6("string")
        .nat("string")
        .nat46("string")
        .nat64("string")
        .natIppool6s("string")
        .natIppools("string")
        .natPort("string")
        .origAddr6("string")
        .comments("string")
        .origAddrs("string")
        .pkgFolderPath("string")
        .adom("string")
        .action("string")
        .policyid(0.0)
        .portPreserve("string")
        .portRandom("string")
        .protocol(0.0)
        .scopetype("string")
        .srcAddr6s("string")
        .srcAddrs("string")
        .srcintfs("string")
        .status("string")
        .type("string")
        .updateIfExist(false)
        .uuid("string")
        .build());
    
    packages_firewall_centralsnatmap_resource = fortimanager.PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource",
        pkg="string",
        orig_port="string",
        packages_firewall_centralsnatmap_id="string",
        dst_addr6="string",
        dst_addrs=["string"],
        dst_port="string",
        dstintfs=["string"],
        ipv6="string",
        nat="string",
        nat46="string",
        nat64="string",
        nat_ippool6s=["string"],
        nat_ippools=["string"],
        nat_port="string",
        orig_addr6="string",
        comments="string",
        orig_addrs=["string"],
        pkg_folder_path="string",
        adom="string",
        action="string",
        policyid=float(0),
        port_preserve="string",
        port_random="string",
        protocol=float(0),
        scopetype="string",
        src_addr6s=["string"],
        src_addrs=["string"],
        srcintfs=["string"],
        status="string",
        type="string",
        update_if_exist=False,
        uuid="string")
    
    const packagesFirewallCentralsnatmapResource = new fortimanager.PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource", {
        pkg: "string",
        origPort: "string",
        packagesFirewallCentralsnatmapId: "string",
        dstAddr6: "string",
        dstAddrs: ["string"],
        dstPort: "string",
        dstintfs: ["string"],
        ipv6: "string",
        nat: "string",
        nat46: "string",
        nat64: "string",
        natIppool6s: ["string"],
        natIppools: ["string"],
        natPort: "string",
        origAddr6: "string",
        comments: "string",
        origAddrs: ["string"],
        pkgFolderPath: "string",
        adom: "string",
        action: "string",
        policyid: 0,
        portPreserve: "string",
        portRandom: "string",
        protocol: 0,
        scopetype: "string",
        srcAddr6s: ["string"],
        srcAddrs: ["string"],
        srcintfs: ["string"],
        status: "string",
        type: "string",
        updateIfExist: false,
        uuid: "string",
    });
    
    type: fortimanager:PackagesFirewallCentralsnatmap
    properties:
        action: string
        adom: string
        comments: string
        dstAddr6: string
        dstAddrs:
            - string
        dstPort: string
        dstintfs:
            - string
        ipv6: string
        nat: string
        nat46: string
        nat64: string
        natIppool6s:
            - string
        natIppools:
            - string
        natPort: string
        origAddr6: string
        origAddrs:
            - string
        origPort: string
        packagesFirewallCentralsnatmapId: string
        pkg: string
        pkgFolderPath: string
        policyid: 0
        portPreserve: string
        portRandom: string
        protocol: 0
        scopetype: string
        srcAddr6s:
            - string
        srcAddrs:
            - string
        srcintfs:
            - string
        status: string
        type: string
        updateIfExist: false
        uuid: string
    

    PackagesFirewallCentralsnatmap Resource Properties

    To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.

    Inputs

    In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.

    The PackagesFirewallCentralsnatmap resource accepts the following input properties:

    Pkg string
    Package.
    Action string
    Action. Valid values: bypass, masquerade, ippool.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Comments string
    Comment.
    DstAddr6 string
    IPv6 Destination address.
    DstAddrs List<string>
    Destination address name from available addresses.
    DstPort string
    Destination port or port range (1 to 65535, 0 means any port).
    Dstintfs List<string>
    Destination interface name from available interfaces.
    Ipv6 string
    Ipv6. Valid values: disable, enable.
    Nat string
    Enable/disable source NAT. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    Nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    NatIppool6s List<string>
    IPv6 pools to be used for source NAT.
    NatIppools List<string>
    Name of the IP pools to be used to translate addresses from available IP Pools.
    NatPort string
    Translated port or port range (0 to 65535).
    OrigAddr6 string
    IPv6 Original address.
    OrigAddrs List<string>
    Original address.
    OrigPort string
    Original TCP port (0 to 65535).
    PackagesFirewallCentralsnatmapId string
    an identifier for the resource with format {{policyid}}.
    PkgFolderPath string
    Pkg Folder Path.
    Policyid double
    Policy ID.
    PortPreserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    PortRandom string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    Protocol double
    Integer value for the protocol type (0 - 255).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SrcAddr6s List<string>
    Src-Addr6.
    SrcAddrs List<string>
    Src-Addr.
    Srcintfs List<string>
    Source interface name from available interfaces.
    Status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    Type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    Pkg string
    Package.
    Action string
    Action. Valid values: bypass, masquerade, ippool.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Comments string
    Comment.
    DstAddr6 string
    IPv6 Destination address.
    DstAddrs []string
    Destination address name from available addresses.
    DstPort string
    Destination port or port range (1 to 65535, 0 means any port).
    Dstintfs []string
    Destination interface name from available interfaces.
    Ipv6 string
    Ipv6. Valid values: disable, enable.
    Nat string
    Enable/disable source NAT. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    Nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    NatIppool6s []string
    IPv6 pools to be used for source NAT.
    NatIppools []string
    Name of the IP pools to be used to translate addresses from available IP Pools.
    NatPort string
    Translated port or port range (0 to 65535).
    OrigAddr6 string
    IPv6 Original address.
    OrigAddrs []string
    Original address.
    OrigPort string
    Original TCP port (0 to 65535).
    PackagesFirewallCentralsnatmapId string
    an identifier for the resource with format {{policyid}}.
    PkgFolderPath string
    Pkg Folder Path.
    Policyid float64
    Policy ID.
    PortPreserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    PortRandom string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    Protocol float64
    Integer value for the protocol type (0 - 255).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SrcAddr6s []string
    Src-Addr6.
    SrcAddrs []string
    Src-Addr.
    Srcintfs []string
    Source interface name from available interfaces.
    Status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    Type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    pkg string
    Package.
    action string
    Action. Valid values: bypass, masquerade, ippool.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments string
    Comment.
    dst_addr6 string
    IPv6 Destination address.
    dst_addrs list(string)
    Destination address name from available addresses.
    dst_port string
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs list(string)
    Destination interface name from available interfaces.
    ipv6 string
    Ipv6. Valid values: disable, enable.
    nat string
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    nat_ippool6s list(string)
    IPv6 pools to be used for source NAT.
    nat_ippools list(string)
    Name of the IP pools to be used to translate addresses from available IP Pools.
    nat_port string
    Translated port or port range (0 to 65535).
    orig_addr6 string
    IPv6 Original address.
    orig_addrs list(string)
    Original address.
    orig_port string
    Original TCP port (0 to 65535).
    packages_firewall_centralsnatmap_id string
    an identifier for the resource with format {{policyid}}.
    pkg_folder_path string
    Pkg Folder Path.
    policyid number
    Policy ID.
    port_preserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    port_random string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol number
    Integer value for the protocol type (0 - 255).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    src_addr6s list(string)
    Src-Addr6.
    src_addrs list(string)
    Src-Addr.
    srcintfs list(string)
    Source interface name from available interfaces.
    status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    update_if_exist bool
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    pkg String
    Package.
    action String
    Action. Valid values: bypass, masquerade, ippool.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments String
    Comment.
    dstAddr6 String
    IPv6 Destination address.
    dstAddrs List<String>
    Destination address name from available addresses.
    dstPort String
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs List<String>
    Destination interface name from available interfaces.
    ipv6 String
    Ipv6. Valid values: disable, enable.
    nat String
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 String
    Enable/disable NAT64. Valid values: disable, enable.
    natIppool6s List<String>
    IPv6 pools to be used for source NAT.
    natIppools List<String>
    Name of the IP pools to be used to translate addresses from available IP Pools.
    natPort String
    Translated port or port range (0 to 65535).
    origAddr6 String
    IPv6 Original address.
    origAddrs List<String>
    Original address.
    origPort String
    Original TCP port (0 to 65535).
    packagesFirewallCentralsnatmapId String
    an identifier for the resource with format {{policyid}}.
    pkgFolderPath String
    Pkg Folder Path.
    policyid Double
    Policy ID.
    portPreserve String
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    portRandom String
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol Double
    Integer value for the protocol type (0 - 255).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    srcAddr6s List<String>
    Src-Addr6.
    srcAddrs List<String>
    Src-Addr.
    srcintfs List<String>
    Source interface name from available interfaces.
    status String
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type String
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    pkg string
    Package.
    action string
    Action. Valid values: bypass, masquerade, ippool.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments string
    Comment.
    dstAddr6 string
    IPv6 Destination address.
    dstAddrs string[]
    Destination address name from available addresses.
    dstPort string
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs string[]
    Destination interface name from available interfaces.
    ipv6 string
    Ipv6. Valid values: disable, enable.
    nat string
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    natIppool6s string[]
    IPv6 pools to be used for source NAT.
    natIppools string[]
    Name of the IP pools to be used to translate addresses from available IP Pools.
    natPort string
    Translated port or port range (0 to 65535).
    origAddr6 string
    IPv6 Original address.
    origAddrs string[]
    Original address.
    origPort string
    Original TCP port (0 to 65535).
    packagesFirewallCentralsnatmapId string
    an identifier for the resource with format {{policyid}}.
    pkgFolderPath string
    Pkg Folder Path.
    policyid number
    Policy ID.
    portPreserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    portRandom string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol number
    Integer value for the protocol type (0 - 255).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    srcAddr6s string[]
    Src-Addr6.
    srcAddrs string[]
    Src-Addr.
    srcintfs string[]
    Source interface name from available interfaces.
    status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    updateIfExist boolean
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    pkg str
    Package.
    action str
    Action. Valid values: bypass, masquerade, ippool.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments str
    Comment.
    dst_addr6 str
    IPv6 Destination address.
    dst_addrs Sequence[str]
    Destination address name from available addresses.
    dst_port str
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs Sequence[str]
    Destination interface name from available interfaces.
    ipv6 str
    Ipv6. Valid values: disable, enable.
    nat str
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 str
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 str
    Enable/disable NAT64. Valid values: disable, enable.
    nat_ippool6s Sequence[str]
    IPv6 pools to be used for source NAT.
    nat_ippools Sequence[str]
    Name of the IP pools to be used to translate addresses from available IP Pools.
    nat_port str
    Translated port or port range (0 to 65535).
    orig_addr6 str
    IPv6 Original address.
    orig_addrs Sequence[str]
    Original address.
    orig_port str
    Original TCP port (0 to 65535).
    packages_firewall_centralsnatmap_id str
    an identifier for the resource with format {{policyid}}.
    pkg_folder_path str
    Pkg Folder Path.
    policyid float
    Policy ID.
    port_preserve str
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    port_random str
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol float
    Integer value for the protocol type (0 - 255).
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    src_addr6s Sequence[str]
    Src-Addr6.
    src_addrs Sequence[str]
    Src-Addr.
    srcintfs Sequence[str]
    Source interface name from available interfaces.
    status str
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type str
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    update_if_exist bool
    uuid str
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    pkg String
    Package.
    action String
    Action. Valid values: bypass, masquerade, ippool.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments String
    Comment.
    dstAddr6 String
    IPv6 Destination address.
    dstAddrs List<String>
    Destination address name from available addresses.
    dstPort String
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs List<String>
    Destination interface name from available interfaces.
    ipv6 String
    Ipv6. Valid values: disable, enable.
    nat String
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 String
    Enable/disable NAT64. Valid values: disable, enable.
    natIppool6s List<String>
    IPv6 pools to be used for source NAT.
    natIppools List<String>
    Name of the IP pools to be used to translate addresses from available IP Pools.
    natPort String
    Translated port or port range (0 to 65535).
    origAddr6 String
    IPv6 Original address.
    origAddrs List<String>
    Original address.
    origPort String
    Original TCP port (0 to 65535).
    packagesFirewallCentralsnatmapId String
    an identifier for the resource with format {{policyid}}.
    pkgFolderPath String
    Pkg Folder Path.
    policyid Number
    Policy ID.
    portPreserve String
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    portRandom String
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol Number
    Integer value for the protocol type (0 - 255).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    srcAddr6s List<String>
    Src-Addr6.
    srcAddrs List<String>
    Src-Addr.
    srcintfs List<String>
    Source interface name from available interfaces.
    status String
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type String
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).

    Outputs

    All input properties are implicitly available as output properties. Additionally, the PackagesFirewallCentralsnatmap resource produces the following output properties:

    Id string
    The provider-assigned unique ID for this managed resource.
    Id string
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.
    id string
    The provider-assigned unique ID for this managed resource.
    id str
    The provider-assigned unique ID for this managed resource.
    id String
    The provider-assigned unique ID for this managed resource.

    Look up Existing PackagesFirewallCentralsnatmap Resource

    Get an existing PackagesFirewallCentralsnatmap resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.

    public static get(name: string, id: Input<ID>, state?: PackagesFirewallCentralsnatmapState, opts?: CustomResourceOptions): PackagesFirewallCentralsnatmap
    @staticmethod
    def get(resource_name: str,
            id: str,
            opts: Optional[ResourceOptions] = None,
            action: Optional[str] = None,
            adom: Optional[str] = None,
            comments: Optional[str] = None,
            dst_addr6: Optional[str] = None,
            dst_addrs: Optional[Sequence[str]] = None,
            dst_port: Optional[str] = None,
            dstintfs: Optional[Sequence[str]] = None,
            ipv6: Optional[str] = None,
            nat: Optional[str] = None,
            nat46: Optional[str] = None,
            nat64: Optional[str] = None,
            nat_ippool6s: Optional[Sequence[str]] = None,
            nat_ippools: Optional[Sequence[str]] = None,
            nat_port: Optional[str] = None,
            orig_addr6: Optional[str] = None,
            orig_addrs: Optional[Sequence[str]] = None,
            orig_port: Optional[str] = None,
            packages_firewall_centralsnatmap_id: Optional[str] = None,
            pkg: Optional[str] = None,
            pkg_folder_path: Optional[str] = None,
            policyid: Optional[float] = None,
            port_preserve: Optional[str] = None,
            port_random: Optional[str] = None,
            protocol: Optional[float] = None,
            scopetype: Optional[str] = None,
            src_addr6s: Optional[Sequence[str]] = None,
            src_addrs: Optional[Sequence[str]] = None,
            srcintfs: Optional[Sequence[str]] = None,
            status: Optional[str] = None,
            type: Optional[str] = None,
            update_if_exist: Optional[bool] = None,
            uuid: Optional[str] = None) -> PackagesFirewallCentralsnatmap
    func GetPackagesFirewallCentralsnatmap(ctx *Context, name string, id IDInput, state *PackagesFirewallCentralsnatmapState, opts ...ResourceOption) (*PackagesFirewallCentralsnatmap, error)
    public static PackagesFirewallCentralsnatmap Get(string name, Input<string> id, PackagesFirewallCentralsnatmapState? state, CustomResourceOptions? opts = null)
    public static PackagesFirewallCentralsnatmap get(String name, Output<String> id, PackagesFirewallCentralsnatmapState state, CustomResourceOptions options)
    resources:  _:    type: fortimanager:PackagesFirewallCentralsnatmap    get:      id: ${id}
    import {
      to = fortimanager_packagesfirewallcentralsnatmap.example
      id = "${id}"
    }
    
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    resource_name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    name
    The unique name of the resulting resource.
    id
    The unique provider ID of the resource to lookup.
    state
    Any extra arguments used during the lookup.
    opts
    A bag of options that control this resource's behavior.
    The following state arguments are supported:
    Action string
    Action. Valid values: bypass, masquerade, ippool.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Comments string
    Comment.
    DstAddr6 string
    IPv6 Destination address.
    DstAddrs List<string>
    Destination address name from available addresses.
    DstPort string
    Destination port or port range (1 to 65535, 0 means any port).
    Dstintfs List<string>
    Destination interface name from available interfaces.
    Ipv6 string
    Ipv6. Valid values: disable, enable.
    Nat string
    Enable/disable source NAT. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    Nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    NatIppool6s List<string>
    IPv6 pools to be used for source NAT.
    NatIppools List<string>
    Name of the IP pools to be used to translate addresses from available IP Pools.
    NatPort string
    Translated port or port range (0 to 65535).
    OrigAddr6 string
    IPv6 Original address.
    OrigAddrs List<string>
    Original address.
    OrigPort string
    Original TCP port (0 to 65535).
    PackagesFirewallCentralsnatmapId string
    an identifier for the resource with format {{policyid}}.
    Pkg string
    Package.
    PkgFolderPath string
    Pkg Folder Path.
    Policyid double
    Policy ID.
    PortPreserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    PortRandom string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    Protocol double
    Integer value for the protocol type (0 - 255).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SrcAddr6s List<string>
    Src-Addr6.
    SrcAddrs List<string>
    Src-Addr.
    Srcintfs List<string>
    Source interface name from available interfaces.
    Status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    Type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    Action string
    Action. Valid values: bypass, masquerade, ippool.
    Adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    Comments string
    Comment.
    DstAddr6 string
    IPv6 Destination address.
    DstAddrs []string
    Destination address name from available addresses.
    DstPort string
    Destination port or port range (1 to 65535, 0 means any port).
    Dstintfs []string
    Destination interface name from available interfaces.
    Ipv6 string
    Ipv6. Valid values: disable, enable.
    Nat string
    Enable/disable source NAT. Valid values: disable, enable.
    Nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    Nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    NatIppool6s []string
    IPv6 pools to be used for source NAT.
    NatIppools []string
    Name of the IP pools to be used to translate addresses from available IP Pools.
    NatPort string
    Translated port or port range (0 to 65535).
    OrigAddr6 string
    IPv6 Original address.
    OrigAddrs []string
    Original address.
    OrigPort string
    Original TCP port (0 to 65535).
    PackagesFirewallCentralsnatmapId string
    an identifier for the resource with format {{policyid}}.
    Pkg string
    Package.
    PkgFolderPath string
    Pkg Folder Path.
    Policyid float64
    Policy ID.
    PortPreserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    PortRandom string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    Protocol float64
    Integer value for the protocol type (0 - 255).
    Scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    SrcAddr6s []string
    Src-Addr6.
    SrcAddrs []string
    Src-Addr.
    Srcintfs []string
    Source interface name from available interfaces.
    Status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    Type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    UpdateIfExist bool
    Uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    action string
    Action. Valid values: bypass, masquerade, ippool.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments string
    Comment.
    dst_addr6 string
    IPv6 Destination address.
    dst_addrs list(string)
    Destination address name from available addresses.
    dst_port string
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs list(string)
    Destination interface name from available interfaces.
    ipv6 string
    Ipv6. Valid values: disable, enable.
    nat string
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    nat_ippool6s list(string)
    IPv6 pools to be used for source NAT.
    nat_ippools list(string)
    Name of the IP pools to be used to translate addresses from available IP Pools.
    nat_port string
    Translated port or port range (0 to 65535).
    orig_addr6 string
    IPv6 Original address.
    orig_addrs list(string)
    Original address.
    orig_port string
    Original TCP port (0 to 65535).
    packages_firewall_centralsnatmap_id string
    an identifier for the resource with format {{policyid}}.
    pkg string
    Package.
    pkg_folder_path string
    Pkg Folder Path.
    policyid number
    Policy ID.
    port_preserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    port_random string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol number
    Integer value for the protocol type (0 - 255).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    src_addr6s list(string)
    Src-Addr6.
    src_addrs list(string)
    Src-Addr.
    srcintfs list(string)
    Source interface name from available interfaces.
    status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    update_if_exist bool
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    action String
    Action. Valid values: bypass, masquerade, ippool.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments String
    Comment.
    dstAddr6 String
    IPv6 Destination address.
    dstAddrs List<String>
    Destination address name from available addresses.
    dstPort String
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs List<String>
    Destination interface name from available interfaces.
    ipv6 String
    Ipv6. Valid values: disable, enable.
    nat String
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 String
    Enable/disable NAT64. Valid values: disable, enable.
    natIppool6s List<String>
    IPv6 pools to be used for source NAT.
    natIppools List<String>
    Name of the IP pools to be used to translate addresses from available IP Pools.
    natPort String
    Translated port or port range (0 to 65535).
    origAddr6 String
    IPv6 Original address.
    origAddrs List<String>
    Original address.
    origPort String
    Original TCP port (0 to 65535).
    packagesFirewallCentralsnatmapId String
    an identifier for the resource with format {{policyid}}.
    pkg String
    Package.
    pkgFolderPath String
    Pkg Folder Path.
    policyid Double
    Policy ID.
    portPreserve String
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    portRandom String
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol Double
    Integer value for the protocol type (0 - 255).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    srcAddr6s List<String>
    Src-Addr6.
    srcAddrs List<String>
    Src-Addr.
    srcintfs List<String>
    Source interface name from available interfaces.
    status String
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type String
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    action string
    Action. Valid values: bypass, masquerade, ippool.
    adom string
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments string
    Comment.
    dstAddr6 string
    IPv6 Destination address.
    dstAddrs string[]
    Destination address name from available addresses.
    dstPort string
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs string[]
    Destination interface name from available interfaces.
    ipv6 string
    Ipv6. Valid values: disable, enable.
    nat string
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 string
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 string
    Enable/disable NAT64. Valid values: disable, enable.
    natIppool6s string[]
    IPv6 pools to be used for source NAT.
    natIppools string[]
    Name of the IP pools to be used to translate addresses from available IP Pools.
    natPort string
    Translated port or port range (0 to 65535).
    origAddr6 string
    IPv6 Original address.
    origAddrs string[]
    Original address.
    origPort string
    Original TCP port (0 to 65535).
    packagesFirewallCentralsnatmapId string
    an identifier for the resource with format {{policyid}}.
    pkg string
    Package.
    pkgFolderPath string
    Pkg Folder Path.
    policyid number
    Policy ID.
    portPreserve string
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    portRandom string
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol number
    Integer value for the protocol type (0 - 255).
    scopetype string
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    srcAddr6s string[]
    Src-Addr6.
    srcAddrs string[]
    Src-Addr.
    srcintfs string[]
    Source interface name from available interfaces.
    status string
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type string
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    updateIfExist boolean
    uuid string
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    action str
    Action. Valid values: bypass, masquerade, ippool.
    adom str
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments str
    Comment.
    dst_addr6 str
    IPv6 Destination address.
    dst_addrs Sequence[str]
    Destination address name from available addresses.
    dst_port str
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs Sequence[str]
    Destination interface name from available interfaces.
    ipv6 str
    Ipv6. Valid values: disable, enable.
    nat str
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 str
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 str
    Enable/disable NAT64. Valid values: disable, enable.
    nat_ippool6s Sequence[str]
    IPv6 pools to be used for source NAT.
    nat_ippools Sequence[str]
    Name of the IP pools to be used to translate addresses from available IP Pools.
    nat_port str
    Translated port or port range (0 to 65535).
    orig_addr6 str
    IPv6 Original address.
    orig_addrs Sequence[str]
    Original address.
    orig_port str
    Original TCP port (0 to 65535).
    packages_firewall_centralsnatmap_id str
    an identifier for the resource with format {{policyid}}.
    pkg str
    Package.
    pkg_folder_path str
    Pkg Folder Path.
    policyid float
    Policy ID.
    port_preserve str
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    port_random str
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol float
    Integer value for the protocol type (0 - 255).
    scopetype str
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    src_addr6s Sequence[str]
    Src-Addr6.
    src_addrs Sequence[str]
    Src-Addr.
    srcintfs Sequence[str]
    Source interface name from available interfaces.
    status str
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type str
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    update_if_exist bool
    uuid str
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
    action String
    Action. Valid values: bypass, masquerade, ippool.
    adom String
    Adom. This value is valid only when the scopetype is adom, otherwise the value of adom in the provider will be inherited.
    comments String
    Comment.
    dstAddr6 String
    IPv6 Destination address.
    dstAddrs List<String>
    Destination address name from available addresses.
    dstPort String
    Destination port or port range (1 to 65535, 0 means any port).
    dstintfs List<String>
    Destination interface name from available interfaces.
    ipv6 String
    Ipv6. Valid values: disable, enable.
    nat String
    Enable/disable source NAT. Valid values: disable, enable.
    nat46 String
    Enable/disable NAT46. Valid values: disable, enable.
    nat64 String
    Enable/disable NAT64. Valid values: disable, enable.
    natIppool6s List<String>
    IPv6 pools to be used for source NAT.
    natIppools List<String>
    Name of the IP pools to be used to translate addresses from available IP Pools.
    natPort String
    Translated port or port range (0 to 65535).
    origAddr6 String
    IPv6 Original address.
    origAddrs List<String>
    Original address.
    origPort String
    Original TCP port (0 to 65535).
    packagesFirewallCentralsnatmapId String
    an identifier for the resource with format {{policyid}}.
    pkg String
    Package.
    pkgFolderPath String
    Pkg Folder Path.
    policyid Number
    Policy ID.
    portPreserve String
    Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values: disable, enable.
    portRandom String
    Enable/disable random source port selection for source NAT. Valid values: disable, enable.
    protocol Number
    Integer value for the protocol type (0 - 255).
    scopetype String
    The scope of application of the resource. Valid values: inherit, adom. The inherit means that the scopetype of the provider will be inherited, and adom will also be inherited. The default value is inherit.
    srcAddr6s List<String>
    Src-Addr6.
    srcAddrs List<String>
    Src-Addr.
    srcintfs List<String>
    Source interface name from available interfaces.
    status String
    Enable/disable the active status of this policy. Valid values: disable, enable.
    type String
    IPv4/IPv6 source NAT. Valid values: ipv4, ipv6.
    updateIfExist Boolean
    uuid String
    Universally Unique Identifier (UUID; automatically assigned but can be manually reset).

    Import

    Packages FirewallCentralSnatMap can be imported using any of these accepted formats:

    Set import_options = [“pkg_folder_path=YOUR_VALUE”, “pkg=YOUR_VALUE”] in the provider section.

    $ export “FORTIMANAGER_IMPORT_TABLE”=“true”

    $ pulumi import fortimanager:index/packagesFirewallCentralsnatmap:PackagesFirewallCentralsnatmap labelname {{policyid}}
    

    $ unset “FORTIMANAGER_IMPORT_TABLE”

    -> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.

    To learn more about importing existing cloud resources, see Importing resources.

    Package Details

    Repository
    fortimanager fortinetdev/terraform-provider-fortimanager
    License
    Notes
    This Pulumi package is based on the fortimanager Terraform Provider.
    Viewing docs for fortimanager 1.17.0
    published on Monday, May 4, 2026 by fortinetdev

      Try Pulumi Cloud free.
      Your team will thank you.

      Start free trial