published on Monday, May 4, 2026 by fortinetdev
published on Monday, May 4, 2026 by fortinetdev
Configure central SNAT policies.
Example Usage
import * as pulumi from "@pulumi/pulumi";
import * as fortimanager from "@pulumi/fortimanager";
const labelname = new fortimanager.PackagesFirewallCentralsnatmap("labelname", {
pkg: "default",
nat: "enable",
natPort: "0",
origPort: "0",
policyid: 1,
protocol: 33,
status: "enable",
dstAddrs: ["all"],
dstintfs: ["port3"],
origAddrs: ["all"],
srcintfs: ["port1"],
});
import pulumi
import pulumi_fortimanager as fortimanager
labelname = fortimanager.PackagesFirewallCentralsnatmap("labelname",
pkg="default",
nat="enable",
nat_port="0",
orig_port="0",
policyid=1,
protocol=33,
status="enable",
dst_addrs=["all"],
dstintfs=["port3"],
orig_addrs=["all"],
srcintfs=["port1"])
package main
import (
"github.com/pulumi/pulumi-terraform-provider/sdks/go/fortimanager/fortimanager"
"github.com/pulumi/pulumi/sdk/v3/go/pulumi"
)
func main() {
pulumi.Run(func(ctx *pulumi.Context) error {
_, err := fortimanager.NewPackagesFirewallCentralsnatmap(ctx, "labelname", &fortimanager.PackagesFirewallCentralsnatmapArgs{
Pkg: pulumi.String("default"),
Nat: pulumi.String("enable"),
NatPort: pulumi.String("0"),
OrigPort: pulumi.String("0"),
Policyid: pulumi.Float64(1),
Protocol: pulumi.Float64(33),
Status: pulumi.String("enable"),
DstAddrs: pulumi.StringArray{
pulumi.String("all"),
},
Dstintfs: pulumi.StringArray{
pulumi.String("port3"),
},
OrigAddrs: pulumi.StringArray{
pulumi.String("all"),
},
Srcintfs: pulumi.StringArray{
pulumi.String("port1"),
},
})
if err != nil {
return err
}
return nil
})
}
using System.Collections.Generic;
using System.Linq;
using Pulumi;
using Fortimanager = Pulumi.Fortimanager;
return await Deployment.RunAsync(() =>
{
var labelname = new Fortimanager.PackagesFirewallCentralsnatmap("labelname", new()
{
Pkg = "default",
Nat = "enable",
NatPort = "0",
OrigPort = "0",
Policyid = 1,
Protocol = 33,
Status = "enable",
DstAddrs = new[]
{
"all",
},
Dstintfs = new[]
{
"port3",
},
OrigAddrs = new[]
{
"all",
},
Srcintfs = new[]
{
"port1",
},
});
});
package generated_program;
import com.pulumi.Context;
import com.pulumi.Pulumi;
import com.pulumi.core.Output;
import com.pulumi.fortimanager.PackagesFirewallCentralsnatmap;
import com.pulumi.fortimanager.PackagesFirewallCentralsnatmapArgs;
import java.util.List;
import java.util.ArrayList;
import java.util.Map;
import java.io.File;
import java.nio.file.Files;
import java.nio.file.Paths;
public class App {
public static void main(String[] args) {
Pulumi.run(App::stack);
}
public static void stack(Context ctx) {
var labelname = new PackagesFirewallCentralsnatmap("labelname", PackagesFirewallCentralsnatmapArgs.builder()
.pkg("default")
.nat("enable")
.natPort("0")
.origPort("0")
.policyid(1.0)
.protocol(33.0)
.status("enable")
.dstAddrs("all")
.dstintfs("port3")
.origAddrs("all")
.srcintfs("port1")
.build());
}
}
resources:
labelname:
type: fortimanager:PackagesFirewallCentralsnatmap
properties:
pkg: default
nat: enable
natPort: '0'
origPort: '0'
policyid: 1
protocol: 33
status: enable
dstAddrs:
- all
dstintfs:
- port3
origAddrs:
- all
srcintfs:
- port1
Example coming soon!
Create PackagesFirewallCentralsnatmap Resource
Resources are created with functions called constructors. To learn more about declaring and configuring resources, see Resources.
Constructor syntax
new PackagesFirewallCentralsnatmap(name: string, args: PackagesFirewallCentralsnatmapArgs, opts?: CustomResourceOptions);@overload
def PackagesFirewallCentralsnatmap(resource_name: str,
args: PackagesFirewallCentralsnatmapArgs,
opts: Optional[ResourceOptions] = None)
@overload
def PackagesFirewallCentralsnatmap(resource_name: str,
opts: Optional[ResourceOptions] = None,
pkg: Optional[str] = None,
orig_port: Optional[str] = None,
packages_firewall_centralsnatmap_id: Optional[str] = None,
dst_addr6: Optional[str] = None,
dst_addrs: Optional[Sequence[str]] = None,
dst_port: Optional[str] = None,
dstintfs: Optional[Sequence[str]] = None,
ipv6: Optional[str] = None,
nat: Optional[str] = None,
nat46: Optional[str] = None,
nat64: Optional[str] = None,
nat_ippool6s: Optional[Sequence[str]] = None,
nat_ippools: Optional[Sequence[str]] = None,
nat_port: Optional[str] = None,
orig_addr6: Optional[str] = None,
comments: Optional[str] = None,
orig_addrs: Optional[Sequence[str]] = None,
pkg_folder_path: Optional[str] = None,
adom: Optional[str] = None,
action: Optional[str] = None,
policyid: Optional[float] = None,
port_preserve: Optional[str] = None,
port_random: Optional[str] = None,
protocol: Optional[float] = None,
scopetype: Optional[str] = None,
src_addr6s: Optional[Sequence[str]] = None,
src_addrs: Optional[Sequence[str]] = None,
srcintfs: Optional[Sequence[str]] = None,
status: Optional[str] = None,
type: Optional[str] = None,
update_if_exist: Optional[bool] = None,
uuid: Optional[str] = None)func NewPackagesFirewallCentralsnatmap(ctx *Context, name string, args PackagesFirewallCentralsnatmapArgs, opts ...ResourceOption) (*PackagesFirewallCentralsnatmap, error)public PackagesFirewallCentralsnatmap(string name, PackagesFirewallCentralsnatmapArgs args, CustomResourceOptions? opts = null)
public PackagesFirewallCentralsnatmap(String name, PackagesFirewallCentralsnatmapArgs args)
public PackagesFirewallCentralsnatmap(String name, PackagesFirewallCentralsnatmapArgs args, CustomResourceOptions options)
type: fortimanager:PackagesFirewallCentralsnatmap
properties: # The arguments to resource properties.
options: # Bag of options to control resource's behavior.
resource "fortimanager_packagesfirewallcentralsnatmap" "name" {
# resource properties
}Parameters
- name string
- The unique name of the resource.
- args PackagesFirewallCentralsnatmapArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- resource_name str
- The unique name of the resource.
- args PackagesFirewallCentralsnatmapArgs
- The arguments to resource properties.
- opts ResourceOptions
- Bag of options to control resource's behavior.
- ctx Context
- Context object for the current deployment.
- name string
- The unique name of the resource.
- args PackagesFirewallCentralsnatmapArgs
- The arguments to resource properties.
- opts ResourceOption
- Bag of options to control resource's behavior.
- name string
- The unique name of the resource.
- args PackagesFirewallCentralsnatmapArgs
- The arguments to resource properties.
- opts CustomResourceOptions
- Bag of options to control resource's behavior.
- name String
- The unique name of the resource.
- args PackagesFirewallCentralsnatmapArgs
- The arguments to resource properties.
- options CustomResourceOptions
- Bag of options to control resource's behavior.
Constructor example
The following reference example uses placeholder values for all input properties.
var packagesFirewallCentralsnatmapResource = new Fortimanager.PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource", new()
{
Pkg = "string",
OrigPort = "string",
PackagesFirewallCentralsnatmapId = "string",
DstAddr6 = "string",
DstAddrs = new[]
{
"string",
},
DstPort = "string",
Dstintfs = new[]
{
"string",
},
Ipv6 = "string",
Nat = "string",
Nat46 = "string",
Nat64 = "string",
NatIppool6s = new[]
{
"string",
},
NatIppools = new[]
{
"string",
},
NatPort = "string",
OrigAddr6 = "string",
Comments = "string",
OrigAddrs = new[]
{
"string",
},
PkgFolderPath = "string",
Adom = "string",
Action = "string",
Policyid = 0,
PortPreserve = "string",
PortRandom = "string",
Protocol = 0,
Scopetype = "string",
SrcAddr6s = new[]
{
"string",
},
SrcAddrs = new[]
{
"string",
},
Srcintfs = new[]
{
"string",
},
Status = "string",
Type = "string",
UpdateIfExist = false,
Uuid = "string",
});
example, err := fortimanager.NewPackagesFirewallCentralsnatmap(ctx, "packagesFirewallCentralsnatmapResource", &fortimanager.PackagesFirewallCentralsnatmapArgs{
Pkg: pulumi.String("string"),
OrigPort: pulumi.String("string"),
PackagesFirewallCentralsnatmapId: pulumi.String("string"),
DstAddr6: pulumi.String("string"),
DstAddrs: pulumi.StringArray{
pulumi.String("string"),
},
DstPort: pulumi.String("string"),
Dstintfs: pulumi.StringArray{
pulumi.String("string"),
},
Ipv6: pulumi.String("string"),
Nat: pulumi.String("string"),
Nat46: pulumi.String("string"),
Nat64: pulumi.String("string"),
NatIppool6s: pulumi.StringArray{
pulumi.String("string"),
},
NatIppools: pulumi.StringArray{
pulumi.String("string"),
},
NatPort: pulumi.String("string"),
OrigAddr6: pulumi.String("string"),
Comments: pulumi.String("string"),
OrigAddrs: pulumi.StringArray{
pulumi.String("string"),
},
PkgFolderPath: pulumi.String("string"),
Adom: pulumi.String("string"),
Action: pulumi.String("string"),
Policyid: pulumi.Float64(0),
PortPreserve: pulumi.String("string"),
PortRandom: pulumi.String("string"),
Protocol: pulumi.Float64(0),
Scopetype: pulumi.String("string"),
SrcAddr6s: pulumi.StringArray{
pulumi.String("string"),
},
SrcAddrs: pulumi.StringArray{
pulumi.String("string"),
},
Srcintfs: pulumi.StringArray{
pulumi.String("string"),
},
Status: pulumi.String("string"),
Type: pulumi.String("string"),
UpdateIfExist: pulumi.Bool(false),
Uuid: pulumi.String("string"),
})
resource "fortimanager_packagesfirewallcentralsnatmap" "packagesFirewallCentralsnatmapResource" {
pkg = "string"
orig_port = "string"
packages_firewall_centralsnatmap_id = "string"
dst_addr6 = "string"
dst_addrs = ["string"]
dst_port = "string"
dstintfs = ["string"]
ipv6 = "string"
nat = "string"
nat46 = "string"
nat64 = "string"
nat_ippool6s = ["string"]
nat_ippools = ["string"]
nat_port = "string"
orig_addr6 = "string"
comments = "string"
orig_addrs = ["string"]
pkg_folder_path = "string"
adom = "string"
action = "string"
policyid = 0
port_preserve = "string"
port_random = "string"
protocol = 0
scopetype = "string"
src_addr6s = ["string"]
src_addrs = ["string"]
srcintfs = ["string"]
status = "string"
type = "string"
update_if_exist = false
uuid = "string"
}
var packagesFirewallCentralsnatmapResource = new PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource", PackagesFirewallCentralsnatmapArgs.builder()
.pkg("string")
.origPort("string")
.packagesFirewallCentralsnatmapId("string")
.dstAddr6("string")
.dstAddrs("string")
.dstPort("string")
.dstintfs("string")
.ipv6("string")
.nat("string")
.nat46("string")
.nat64("string")
.natIppool6s("string")
.natIppools("string")
.natPort("string")
.origAddr6("string")
.comments("string")
.origAddrs("string")
.pkgFolderPath("string")
.adom("string")
.action("string")
.policyid(0.0)
.portPreserve("string")
.portRandom("string")
.protocol(0.0)
.scopetype("string")
.srcAddr6s("string")
.srcAddrs("string")
.srcintfs("string")
.status("string")
.type("string")
.updateIfExist(false)
.uuid("string")
.build());
packages_firewall_centralsnatmap_resource = fortimanager.PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource",
pkg="string",
orig_port="string",
packages_firewall_centralsnatmap_id="string",
dst_addr6="string",
dst_addrs=["string"],
dst_port="string",
dstintfs=["string"],
ipv6="string",
nat="string",
nat46="string",
nat64="string",
nat_ippool6s=["string"],
nat_ippools=["string"],
nat_port="string",
orig_addr6="string",
comments="string",
orig_addrs=["string"],
pkg_folder_path="string",
adom="string",
action="string",
policyid=float(0),
port_preserve="string",
port_random="string",
protocol=float(0),
scopetype="string",
src_addr6s=["string"],
src_addrs=["string"],
srcintfs=["string"],
status="string",
type="string",
update_if_exist=False,
uuid="string")
const packagesFirewallCentralsnatmapResource = new fortimanager.PackagesFirewallCentralsnatmap("packagesFirewallCentralsnatmapResource", {
pkg: "string",
origPort: "string",
packagesFirewallCentralsnatmapId: "string",
dstAddr6: "string",
dstAddrs: ["string"],
dstPort: "string",
dstintfs: ["string"],
ipv6: "string",
nat: "string",
nat46: "string",
nat64: "string",
natIppool6s: ["string"],
natIppools: ["string"],
natPort: "string",
origAddr6: "string",
comments: "string",
origAddrs: ["string"],
pkgFolderPath: "string",
adom: "string",
action: "string",
policyid: 0,
portPreserve: "string",
portRandom: "string",
protocol: 0,
scopetype: "string",
srcAddr6s: ["string"],
srcAddrs: ["string"],
srcintfs: ["string"],
status: "string",
type: "string",
updateIfExist: false,
uuid: "string",
});
type: fortimanager:PackagesFirewallCentralsnatmap
properties:
action: string
adom: string
comments: string
dstAddr6: string
dstAddrs:
- string
dstPort: string
dstintfs:
- string
ipv6: string
nat: string
nat46: string
nat64: string
natIppool6s:
- string
natIppools:
- string
natPort: string
origAddr6: string
origAddrs:
- string
origPort: string
packagesFirewallCentralsnatmapId: string
pkg: string
pkgFolderPath: string
policyid: 0
portPreserve: string
portRandom: string
protocol: 0
scopetype: string
srcAddr6s:
- string
srcAddrs:
- string
srcintfs:
- string
status: string
type: string
updateIfExist: false
uuid: string
PackagesFirewallCentralsnatmap Resource Properties
To learn more about resource properties and how to use them, see Inputs and Outputs in the Architecture and Concepts docs.
Inputs
In Python, inputs that are objects can be passed either as argument classes or as dictionary literals.
The PackagesFirewallCentralsnatmap resource accepts the following input properties:
- Pkg string
- Package.
- Action string
- Action. Valid values:
bypass,masquerade,ippool. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Comments string
- Comment.
- Dst
Addr6 string - IPv6 Destination address.
- Dst
Addrs List<string> - Destination address name from available addresses.
- Dst
Port string - Destination port or port range (1 to 65535, 0 means any port).
- Dstintfs List<string>
- Destination interface name from available interfaces.
- Ipv6 string
- Ipv6. Valid values:
disable,enable. - Nat string
- Enable/disable source NAT. Valid values:
disable,enable. - Nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - Nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - Nat
Ippool6s List<string> - IPv6 pools to be used for source NAT.
- Nat
Ippools List<string> - Name of the IP pools to be used to translate addresses from available IP Pools.
- Nat
Port string - Translated port or port range (0 to 65535).
- Orig
Addr6 string - IPv6 Original address.
- Orig
Addrs List<string> - Original address.
- Orig
Port string - Original TCP port (0 to 65535).
- Packages
Firewall stringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- Pkg
Folder stringPath - Pkg Folder Path.
- Policyid double
- Policy ID.
- Port
Preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - Port
Random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - Protocol double
- Integer value for the protocol type (0 - 255).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Src
Addr6s List<string> - Src-Addr6.
- Src
Addrs List<string> - Src-Addr.
- Srcintfs List<string>
- Source interface name from available interfaces.
- Status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - Type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Pkg string
- Package.
- Action string
- Action. Valid values:
bypass,masquerade,ippool. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Comments string
- Comment.
- Dst
Addr6 string - IPv6 Destination address.
- Dst
Addrs []string - Destination address name from available addresses.
- Dst
Port string - Destination port or port range (1 to 65535, 0 means any port).
- Dstintfs []string
- Destination interface name from available interfaces.
- Ipv6 string
- Ipv6. Valid values:
disable,enable. - Nat string
- Enable/disable source NAT. Valid values:
disable,enable. - Nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - Nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - Nat
Ippool6s []string - IPv6 pools to be used for source NAT.
- Nat
Ippools []string - Name of the IP pools to be used to translate addresses from available IP Pools.
- Nat
Port string - Translated port or port range (0 to 65535).
- Orig
Addr6 string - IPv6 Original address.
- Orig
Addrs []string - Original address.
- Orig
Port string - Original TCP port (0 to 65535).
- Packages
Firewall stringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- Pkg
Folder stringPath - Pkg Folder Path.
- Policyid float64
- Policy ID.
- Port
Preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - Port
Random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - Protocol float64
- Integer value for the protocol type (0 - 255).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Src
Addr6s []string - Src-Addr6.
- Src
Addrs []string - Src-Addr.
- Srcintfs []string
- Source interface name from available interfaces.
- Status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - Type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- pkg string
- Package.
- action string
- Action. Valid values:
bypass,masquerade,ippool. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments string
- Comment.
- dst_
addr6 string - IPv6 Destination address.
- dst_
addrs list(string) - Destination address name from available addresses.
- dst_
port string - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs list(string)
- Destination interface name from available interfaces.
- ipv6 string
- Ipv6. Valid values:
disable,enable. - nat string
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - nat_
ippool6s list(string) - IPv6 pools to be used for source NAT.
- nat_
ippools list(string) - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat_
port string - Translated port or port range (0 to 65535).
- orig_
addr6 string - IPv6 Original address.
- orig_
addrs list(string) - Original address.
- orig_
port string - Original TCP port (0 to 65535).
- packages_
firewall_ stringcentralsnatmap_ id - an identifier for the resource with format {{policyid}}.
- pkg_
folder_ stringpath - Pkg Folder Path.
- policyid number
- Policy ID.
- port_
preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port_
random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol number
- Integer value for the protocol type (0 - 255).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src_
addr6s list(string) - Src-Addr6.
- src_
addrs list(string) - Src-Addr.
- srcintfs list(string)
- Source interface name from available interfaces.
- status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update_
if_ boolexist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- pkg String
- Package.
- action String
- Action. Valid values:
bypass,masquerade,ippool. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments String
- Comment.
- dst
Addr6 String - IPv6 Destination address.
- dst
Addrs List<String> - Destination address name from available addresses.
- dst
Port String - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs List<String>
- Destination interface name from available interfaces.
- ipv6 String
- Ipv6. Valid values:
disable,enable. - nat String
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 String
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 String
- Enable/disable NAT64. Valid values:
disable,enable. - nat
Ippool6s List<String> - IPv6 pools to be used for source NAT.
- nat
Ippools List<String> - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat
Port String - Translated port or port range (0 to 65535).
- orig
Addr6 String - IPv6 Original address.
- orig
Addrs List<String> - Original address.
- orig
Port String - Original TCP port (0 to 65535).
- packages
Firewall StringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- pkg
Folder StringPath - Pkg Folder Path.
- policyid Double
- Policy ID.
- port
Preserve String - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port
Random String - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol Double
- Integer value for the protocol type (0 - 255).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src
Addr6s List<String> - Src-Addr6.
- src
Addrs List<String> - Src-Addr.
- srcintfs List<String>
- Source interface name from available interfaces.
- status String
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type String
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- pkg string
- Package.
- action string
- Action. Valid values:
bypass,masquerade,ippool. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments string
- Comment.
- dst
Addr6 string - IPv6 Destination address.
- dst
Addrs string[] - Destination address name from available addresses.
- dst
Port string - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs string[]
- Destination interface name from available interfaces.
- ipv6 string
- Ipv6. Valid values:
disable,enable. - nat string
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - nat
Ippool6s string[] - IPv6 pools to be used for source NAT.
- nat
Ippools string[] - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat
Port string - Translated port or port range (0 to 65535).
- orig
Addr6 string - IPv6 Original address.
- orig
Addrs string[] - Original address.
- orig
Port string - Original TCP port (0 to 65535).
- packages
Firewall stringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- pkg
Folder stringPath - Pkg Folder Path.
- policyid number
- Policy ID.
- port
Preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port
Random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol number
- Integer value for the protocol type (0 - 255).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src
Addr6s string[] - Src-Addr6.
- src
Addrs string[] - Src-Addr.
- srcintfs string[]
- Source interface name from available interfaces.
- status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update
If booleanExist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- pkg str
- Package.
- action str
- Action. Valid values:
bypass,masquerade,ippool. - adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments str
- Comment.
- dst_
addr6 str - IPv6 Destination address.
- dst_
addrs Sequence[str] - Destination address name from available addresses.
- dst_
port str - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs Sequence[str]
- Destination interface name from available interfaces.
- ipv6 str
- Ipv6. Valid values:
disable,enable. - nat str
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 str
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 str
- Enable/disable NAT64. Valid values:
disable,enable. - nat_
ippool6s Sequence[str] - IPv6 pools to be used for source NAT.
- nat_
ippools Sequence[str] - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat_
port str - Translated port or port range (0 to 65535).
- orig_
addr6 str - IPv6 Original address.
- orig_
addrs Sequence[str] - Original address.
- orig_
port str - Original TCP port (0 to 65535).
- packages_
firewall_ strcentralsnatmap_ id - an identifier for the resource with format {{policyid}}.
- pkg_
folder_ strpath - Pkg Folder Path.
- policyid float
- Policy ID.
- port_
preserve str - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port_
random str - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol float
- Integer value for the protocol type (0 - 255).
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src_
addr6s Sequence[str] - Src-Addr6.
- src_
addrs Sequence[str] - Src-Addr.
- srcintfs Sequence[str]
- Source interface name from available interfaces.
- status str
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type str
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update_
if_ boolexist - uuid str
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- pkg String
- Package.
- action String
- Action. Valid values:
bypass,masquerade,ippool. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments String
- Comment.
- dst
Addr6 String - IPv6 Destination address.
- dst
Addrs List<String> - Destination address name from available addresses.
- dst
Port String - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs List<String>
- Destination interface name from available interfaces.
- ipv6 String
- Ipv6. Valid values:
disable,enable. - nat String
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 String
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 String
- Enable/disable NAT64. Valid values:
disable,enable. - nat
Ippool6s List<String> - IPv6 pools to be used for source NAT.
- nat
Ippools List<String> - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat
Port String - Translated port or port range (0 to 65535).
- orig
Addr6 String - IPv6 Original address.
- orig
Addrs List<String> - Original address.
- orig
Port String - Original TCP port (0 to 65535).
- packages
Firewall StringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- pkg
Folder StringPath - Pkg Folder Path.
- policyid Number
- Policy ID.
- port
Preserve String - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port
Random String - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol Number
- Integer value for the protocol type (0 - 255).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src
Addr6s List<String> - Src-Addr6.
- src
Addrs List<String> - Src-Addr.
- srcintfs List<String>
- Source interface name from available interfaces.
- status String
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type String
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
Outputs
All input properties are implicitly available as output properties. Additionally, the PackagesFirewallCentralsnatmap resource produces the following output properties:
- Id string
- The provider-assigned unique ID for this managed resource.
- Id string
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
- id string
- The provider-assigned unique ID for this managed resource.
- id str
- The provider-assigned unique ID for this managed resource.
- id String
- The provider-assigned unique ID for this managed resource.
Look up Existing PackagesFirewallCentralsnatmap Resource
Get an existing PackagesFirewallCentralsnatmap resource’s state with the given name, ID, and optional extra properties used to qualify the lookup.
public static get(name: string, id: Input<ID>, state?: PackagesFirewallCentralsnatmapState, opts?: CustomResourceOptions): PackagesFirewallCentralsnatmap@staticmethod
def get(resource_name: str,
id: str,
opts: Optional[ResourceOptions] = None,
action: Optional[str] = None,
adom: Optional[str] = None,
comments: Optional[str] = None,
dst_addr6: Optional[str] = None,
dst_addrs: Optional[Sequence[str]] = None,
dst_port: Optional[str] = None,
dstintfs: Optional[Sequence[str]] = None,
ipv6: Optional[str] = None,
nat: Optional[str] = None,
nat46: Optional[str] = None,
nat64: Optional[str] = None,
nat_ippool6s: Optional[Sequence[str]] = None,
nat_ippools: Optional[Sequence[str]] = None,
nat_port: Optional[str] = None,
orig_addr6: Optional[str] = None,
orig_addrs: Optional[Sequence[str]] = None,
orig_port: Optional[str] = None,
packages_firewall_centralsnatmap_id: Optional[str] = None,
pkg: Optional[str] = None,
pkg_folder_path: Optional[str] = None,
policyid: Optional[float] = None,
port_preserve: Optional[str] = None,
port_random: Optional[str] = None,
protocol: Optional[float] = None,
scopetype: Optional[str] = None,
src_addr6s: Optional[Sequence[str]] = None,
src_addrs: Optional[Sequence[str]] = None,
srcintfs: Optional[Sequence[str]] = None,
status: Optional[str] = None,
type: Optional[str] = None,
update_if_exist: Optional[bool] = None,
uuid: Optional[str] = None) -> PackagesFirewallCentralsnatmapfunc GetPackagesFirewallCentralsnatmap(ctx *Context, name string, id IDInput, state *PackagesFirewallCentralsnatmapState, opts ...ResourceOption) (*PackagesFirewallCentralsnatmap, error)public static PackagesFirewallCentralsnatmap Get(string name, Input<string> id, PackagesFirewallCentralsnatmapState? state, CustomResourceOptions? opts = null)public static PackagesFirewallCentralsnatmap get(String name, Output<String> id, PackagesFirewallCentralsnatmapState state, CustomResourceOptions options)resources: _: type: fortimanager:PackagesFirewallCentralsnatmap get: id: ${id}import {
to = fortimanager_packagesfirewallcentralsnatmap.example
id = "${id}"
}
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- resource_name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- name
- The unique name of the resulting resource.
- id
- The unique provider ID of the resource to lookup.
- state
- Any extra arguments used during the lookup.
- opts
- A bag of options that control this resource's behavior.
- Action string
- Action. Valid values:
bypass,masquerade,ippool. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Comments string
- Comment.
- Dst
Addr6 string - IPv6 Destination address.
- Dst
Addrs List<string> - Destination address name from available addresses.
- Dst
Port string - Destination port or port range (1 to 65535, 0 means any port).
- Dstintfs List<string>
- Destination interface name from available interfaces.
- Ipv6 string
- Ipv6. Valid values:
disable,enable. - Nat string
- Enable/disable source NAT. Valid values:
disable,enable. - Nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - Nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - Nat
Ippool6s List<string> - IPv6 pools to be used for source NAT.
- Nat
Ippools List<string> - Name of the IP pools to be used to translate addresses from available IP Pools.
- Nat
Port string - Translated port or port range (0 to 65535).
- Orig
Addr6 string - IPv6 Original address.
- Orig
Addrs List<string> - Original address.
- Orig
Port string - Original TCP port (0 to 65535).
- Packages
Firewall stringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- Pkg string
- Package.
- Pkg
Folder stringPath - Pkg Folder Path.
- Policyid double
- Policy ID.
- Port
Preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - Port
Random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - Protocol double
- Integer value for the protocol type (0 - 255).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Src
Addr6s List<string> - Src-Addr6.
- Src
Addrs List<string> - Src-Addr.
- Srcintfs List<string>
- Source interface name from available interfaces.
- Status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - Type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- Action string
- Action. Valid values:
bypass,masquerade,ippool. - Adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - Comments string
- Comment.
- Dst
Addr6 string - IPv6 Destination address.
- Dst
Addrs []string - Destination address name from available addresses.
- Dst
Port string - Destination port or port range (1 to 65535, 0 means any port).
- Dstintfs []string
- Destination interface name from available interfaces.
- Ipv6 string
- Ipv6. Valid values:
disable,enable. - Nat string
- Enable/disable source NAT. Valid values:
disable,enable. - Nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - Nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - Nat
Ippool6s []string - IPv6 pools to be used for source NAT.
- Nat
Ippools []string - Name of the IP pools to be used to translate addresses from available IP Pools.
- Nat
Port string - Translated port or port range (0 to 65535).
- Orig
Addr6 string - IPv6 Original address.
- Orig
Addrs []string - Original address.
- Orig
Port string - Original TCP port (0 to 65535).
- Packages
Firewall stringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- Pkg string
- Package.
- Pkg
Folder stringPath - Pkg Folder Path.
- Policyid float64
- Policy ID.
- Port
Preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - Port
Random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - Protocol float64
- Integer value for the protocol type (0 - 255).
- Scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - Src
Addr6s []string - Src-Addr6.
- Src
Addrs []string - Src-Addr.
- Srcintfs []string
- Source interface name from available interfaces.
- Status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - Type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - Update
If boolExist - Uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- action string
- Action. Valid values:
bypass,masquerade,ippool. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments string
- Comment.
- dst_
addr6 string - IPv6 Destination address.
- dst_
addrs list(string) - Destination address name from available addresses.
- dst_
port string - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs list(string)
- Destination interface name from available interfaces.
- ipv6 string
- Ipv6. Valid values:
disable,enable. - nat string
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - nat_
ippool6s list(string) - IPv6 pools to be used for source NAT.
- nat_
ippools list(string) - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat_
port string - Translated port or port range (0 to 65535).
- orig_
addr6 string - IPv6 Original address.
- orig_
addrs list(string) - Original address.
- orig_
port string - Original TCP port (0 to 65535).
- packages_
firewall_ stringcentralsnatmap_ id - an identifier for the resource with format {{policyid}}.
- pkg string
- Package.
- pkg_
folder_ stringpath - Pkg Folder Path.
- policyid number
- Policy ID.
- port_
preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port_
random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol number
- Integer value for the protocol type (0 - 255).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src_
addr6s list(string) - Src-Addr6.
- src_
addrs list(string) - Src-Addr.
- srcintfs list(string)
- Source interface name from available interfaces.
- status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update_
if_ boolexist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- action String
- Action. Valid values:
bypass,masquerade,ippool. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments String
- Comment.
- dst
Addr6 String - IPv6 Destination address.
- dst
Addrs List<String> - Destination address name from available addresses.
- dst
Port String - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs List<String>
- Destination interface name from available interfaces.
- ipv6 String
- Ipv6. Valid values:
disable,enable. - nat String
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 String
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 String
- Enable/disable NAT64. Valid values:
disable,enable. - nat
Ippool6s List<String> - IPv6 pools to be used for source NAT.
- nat
Ippools List<String> - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat
Port String - Translated port or port range (0 to 65535).
- orig
Addr6 String - IPv6 Original address.
- orig
Addrs List<String> - Original address.
- orig
Port String - Original TCP port (0 to 65535).
- packages
Firewall StringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- pkg String
- Package.
- pkg
Folder StringPath - Pkg Folder Path.
- policyid Double
- Policy ID.
- port
Preserve String - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port
Random String - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol Double
- Integer value for the protocol type (0 - 255).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src
Addr6s List<String> - Src-Addr6.
- src
Addrs List<String> - Src-Addr.
- srcintfs List<String>
- Source interface name from available interfaces.
- status String
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type String
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- action string
- Action. Valid values:
bypass,masquerade,ippool. - adom string
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments string
- Comment.
- dst
Addr6 string - IPv6 Destination address.
- dst
Addrs string[] - Destination address name from available addresses.
- dst
Port string - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs string[]
- Destination interface name from available interfaces.
- ipv6 string
- Ipv6. Valid values:
disable,enable. - nat string
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 string
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 string
- Enable/disable NAT64. Valid values:
disable,enable. - nat
Ippool6s string[] - IPv6 pools to be used for source NAT.
- nat
Ippools string[] - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat
Port string - Translated port or port range (0 to 65535).
- orig
Addr6 string - IPv6 Original address.
- orig
Addrs string[] - Original address.
- orig
Port string - Original TCP port (0 to 65535).
- packages
Firewall stringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- pkg string
- Package.
- pkg
Folder stringPath - Pkg Folder Path.
- policyid number
- Policy ID.
- port
Preserve string - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port
Random string - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol number
- Integer value for the protocol type (0 - 255).
- scopetype string
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src
Addr6s string[] - Src-Addr6.
- src
Addrs string[] - Src-Addr.
- srcintfs string[]
- Source interface name from available interfaces.
- status string
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type string
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update
If booleanExist - uuid string
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- action str
- Action. Valid values:
bypass,masquerade,ippool. - adom str
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments str
- Comment.
- dst_
addr6 str - IPv6 Destination address.
- dst_
addrs Sequence[str] - Destination address name from available addresses.
- dst_
port str - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs Sequence[str]
- Destination interface name from available interfaces.
- ipv6 str
- Ipv6. Valid values:
disable,enable. - nat str
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 str
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 str
- Enable/disable NAT64. Valid values:
disable,enable. - nat_
ippool6s Sequence[str] - IPv6 pools to be used for source NAT.
- nat_
ippools Sequence[str] - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat_
port str - Translated port or port range (0 to 65535).
- orig_
addr6 str - IPv6 Original address.
- orig_
addrs Sequence[str] - Original address.
- orig_
port str - Original TCP port (0 to 65535).
- packages_
firewall_ strcentralsnatmap_ id - an identifier for the resource with format {{policyid}}.
- pkg str
- Package.
- pkg_
folder_ strpath - Pkg Folder Path.
- policyid float
- Policy ID.
- port_
preserve str - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port_
random str - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol float
- Integer value for the protocol type (0 - 255).
- scopetype str
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src_
addr6s Sequence[str] - Src-Addr6.
- src_
addrs Sequence[str] - Src-Addr.
- srcintfs Sequence[str]
- Source interface name from available interfaces.
- status str
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type str
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update_
if_ boolexist - uuid str
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
- action String
- Action. Valid values:
bypass,masquerade,ippool. - adom String
- Adom. This value is valid only when the
scopetypeisadom, otherwise the value of adom in the provider will be inherited. - comments String
- Comment.
- dst
Addr6 String - IPv6 Destination address.
- dst
Addrs List<String> - Destination address name from available addresses.
- dst
Port String - Destination port or port range (1 to 65535, 0 means any port).
- dstintfs List<String>
- Destination interface name from available interfaces.
- ipv6 String
- Ipv6. Valid values:
disable,enable. - nat String
- Enable/disable source NAT. Valid values:
disable,enable. - nat46 String
- Enable/disable NAT46. Valid values:
disable,enable. - nat64 String
- Enable/disable NAT64. Valid values:
disable,enable. - nat
Ippool6s List<String> - IPv6 pools to be used for source NAT.
- nat
Ippools List<String> - Name of the IP pools to be used to translate addresses from available IP Pools.
- nat
Port String - Translated port or port range (0 to 65535).
- orig
Addr6 String - IPv6 Original address.
- orig
Addrs List<String> - Original address.
- orig
Port String - Original TCP port (0 to 65535).
- packages
Firewall StringCentralsnatmap Id - an identifier for the resource with format {{policyid}}.
- pkg String
- Package.
- pkg
Folder StringPath - Pkg Folder Path.
- policyid Number
- Policy ID.
- port
Preserve String - Enable/disable preservation of the original source port from source NAT if it has not been used. Valid values:
disable,enable. - port
Random String - Enable/disable random source port selection for source NAT. Valid values:
disable,enable. - protocol Number
- Integer value for the protocol type (0 - 255).
- scopetype String
- The scope of application of the resource. Valid values:
inherit,adom. Theinheritmeans that the scopetype of the provider will be inherited, and adom will also be inherited. The default value isinherit. - src
Addr6s List<String> - Src-Addr6.
- src
Addrs List<String> - Src-Addr.
- srcintfs List<String>
- Source interface name from available interfaces.
- status String
- Enable/disable the active status of this policy. Valid values:
disable,enable. - type String
- IPv4/IPv6 source NAT. Valid values:
ipv4,ipv6. - update
If BooleanExist - uuid String
- Universally Unique Identifier (UUID; automatically assigned but can be manually reset).
Import
Packages FirewallCentralSnatMap can be imported using any of these accepted formats:
Set import_options = [“pkg_folder_path=YOUR_VALUE”, “pkg=YOUR_VALUE”] in the provider section.
$ export “FORTIMANAGER_IMPORT_TABLE”=“true”
$ pulumi import fortimanager:index/packagesFirewallCentralsnatmap:PackagesFirewallCentralsnatmap labelname {{policyid}}
$ unset “FORTIMANAGER_IMPORT_TABLE”
-> Hint: The scopetype and adom for import will directly inherit the scopetype and adom configuration of the provider.
To learn more about importing existing cloud resources, see Importing resources.
Package Details
- Repository
- fortimanager fortinetdev/terraform-provider-fortimanager
- License
- Notes
- This Pulumi package is based on the
fortimanagerTerraform Provider.
published on Monday, May 4, 2026 by fortinetdev
